KEGG   Rhodospirillum centenum: RC1_0239Help
Entry
RC1_0239          CDS       T00785                                 

Gene name
cbbL2
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rce  Rhodospirillum centenum
Pathway
rce00630  Glyoxylate and dicarboxylate metabolism
rce00710  Carbon fixation in photosynthetic organisms
rce01100  Metabolic pathways
rce01120  Microbial metabolism in diverse environments
rce01200  Carbon metabolism
Module
rce_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rce_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rce_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_0239 (cbbL2)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_0239 (cbbL2)
Enzymes [BR:rce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RC1_0239 (cbbL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACI97688
UniProt: B6IQF2
LinkDB All DBs
Position
228179..229597
Genome map
AA seq 472 aa AA seqDB search
MGKTYQAGVKEYRETYWDPNYTPKDSDILACFKVVPQPGVPREEAAAAVCAESSTATWTT
VWTDLLTDLDYYKGRAYAIEDVPGDDEAFYAFVAYPMGLFEEGSIVNVFTSLVGNVFGFK
AVRSLRLEDVRFPLWFVTTCDGPPHGIQVERDKLDKYGRPLLGCTIKPKLGLSAKNYGRA
VYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCQEAIEKAEAETGERKGHYLNVTAPNME
EIYRRAEYAKEIGSPIIMSDYLTIGWAAHSSLSRWCRNNGMLLHVHRAMHGVIDRNPRHG
INFRVLAKLLRLLGGDHLHSGTVVGKLEGDREATLGWVDLMRERHVKEDRSRGLFFDQEW
GHMAPVMPVASGGIHVWHMPALLSIFGDDAVFQFGGGTLGHPWGNAAGACANRVALEACV
EARNQGRDVEREGKDILTAAARHSPELKMAMETWKEVRFEFDVVDKLDVVHR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacctatcaggcaggcgtcaaagagtaccgtgagacctactgggacccgaac
tacacgccgaaggacagcgacatcctggcctgcttcaaggtggtcccgcagccgggggtc
ccgcgcgaagaagccgcagcggccgtctgcgccgaatcctccaccgcgacctggaccacg
gtctggaccgacctgctgaccgacctcgactactacaagggccgggcctacgcgatcgag
gacgtgccgggcgatgacgaggcgttctacgccttcgtggcctacccgatgggcctgttc
gaggagggctccatcgtcaacgtcttcacctcgctggtcggcaacgtcttcggcttcaag
gcggtgcgctccctgcggctggaggatgtgcgcttcccgctctggttcgtcaccacctgc
gacggcccgccccacggcatccaggtcgagcgcgacaagctggacaagtacggccgcccg
ctgctgggctgcacgatcaagccgaagctcgggctgtcggcgaagaactacggccgggcg
gtctatgagtgcctgcgcggcggcctggacttcaccaaggacgacgagaacgtcaactcc
cagcccttcatgcgctggcgcgaccgcttcctgttctgccaggaggcgatcgagaaggcc
gaggcggagaccggcgagcgcaagggccactacctgaacgtcacagcgcccaacatggag
gagatctaccgccgggccgagtacgccaaggagatcggctcgccgatcatcatgagcgac
tatctgacgatcggctgggcggcccattccagcctgtcgcgctggtgccgcaacaacggg
atgctgctgcacgtccaccgggcgatgcacggcgtcatcgaccgcaacccgcggcacggc
atcaacttccgggtcctggccaagctgctgcgcctgctgggcggcgaccacctgcattcc
ggcaccgtcgtcggcaagctggaaggcgaccgcgaggcgacgctcggctgggtggacctg
atgcgcgagcgccatgtgaaggaggatcgcagccgcggcctcttcttcgaccaggaatgg
ggccacatggcgccggtcatgccggtcgcttcgggcggcatccatgtctggcacatgccg
gccctgctctcgatcttcggtgacgatgccgtcttccagttcggcggcggcacgctgggg
catccctggggcaacgctgccggcgcctgtgccaaccgcgtggcgctggaggcctgcgtc
gaggcgcgcaaccagggccgcgacgtggagcgcgagggcaaggacatcctgaccgccgcc
gcccgccacagccccgaactgaagatggcgatggagacctggaaggaggtccgcttcgag
ttcgacgtggtggacaagctcgacgtcgtccaccgctga

DBGET integrated database retrieval system