KEGG   Rhodospirillum centenum: RC1_1195Help
Entry
RC1_1195          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09949  uncharacterized protein
Organism
rce  Rhodospirillum centenum
Brite
KEGG Orthology (KO) [BR:rce00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RC1_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxI_C LpxI_N
Motif
Other DBs
NCBI-ProteinID: ACI98609
UniProt: B6IST8
LinkDB All DBs
Position
complement(1249418..1250254)
Genome map
AA seq 278 aa AA seqDB search
MAPRLAILAGGGDLPGRLAETCHSAGRDVVLVALEGQAEPDRLPSGLPTAWFRMGAVGAI
LDHLRTAGVGDIALAGRVRRPSLGELRPDWKAAQILARVGALALGDDGLLRAVACVLEAE
GFRVVGVPDLMADLLMPEGPVGGLDAPAECRDDIGRGVAVARALGRLDVGQAVVVQQGIV
LGVEAIEGTDALIDRCGDLKREGRGPVLVKVRKPQQDRRLDLPTIGTETVARAARAGFAG
IAAEAGSAILLGRDQVARAADAAGLFVVGTPAGAEEHP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccggctggccatcctcgcaggcggcggcgacctgccgggccgccttgcggag
acctgccacagcgccgggcgggacgtggtgctggtggcgctggaggggcaggcggaaccc
gaccgcctgccgtcaggcctgccgaccgcctggttccgcatgggggctgtcggcgccatc
ctcgaccatctgcgcacggcgggcgtgggcgacatcgccctggcgggccgggtccgccgg
ccgtcgctcggcgaactccgtcccgactggaaggcggcacagatcctggcccgcgtgggt
gccctcgcgctcggcgacgacgggctgctgcgcgccgtcgcctgtgtgctggaggccgag
gggttccgcgtcgtcggcgtgccggatctgatggcggacctgctgatgccggaggggccg
gtcggcggtctggatgccccggcagaatgccgggatgatatcgggcgcggcgttgccgtg
gcccgggccctcggccgcctggatgtcggtcaggcggtggtggtgcagcagggcatcgtg
ctgggggtggaggcgatcgaggggacggacgccctgatcgaccgctgcggcgacttgaag
cgggaggggcgcgggccggttctggtcaaggtccgcaaaccccagcaggataggcgcctc
gatctgccgacgatcgggacggagaccgtggcgcgggcggcccgcgccggcttcgccggc
atcgccgcggaggccgggagcgcgatccttctgggacgcgatcaggtcgcccgcgcggcc
gatgcggccgggctgttcgtcgtcggcacccccgccggcgcagaggagcacccgtga

DBGET integrated database retrieval system