KEGG   Rhodospirillum centenum: RC1_2264Help
Entry
RC1_2264          CDS       T00785                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rce  Rhodospirillum centenum
Pathway
rce00020  Citrate cycle (TCA cycle)
rce00310  Lysine degradation
rce00380  Tryptophan metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
Module
rce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RC1_2264 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    RC1_2264 (sucA)
   00380 Tryptophan metabolism
    RC1_2264 (sucA)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RC1_2264 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N DUF501
Motif
Other DBs
NCBI-ProteinID: ACI99651
UniProt: B6IPE9
LinkDB All DBs
Position
complement(2334166..2337093)
Genome map
AA seq 975 aa AA seqDB search
MAPLDFAPSERDSFLFGANATFIAELYAKFQKDPSSVDPSWQSFFAELGDDAAELLAELR
GASWSSNDAGVIGTSDAEPAVRPARPAPAAAPAPAGSAASGLSVDQVRRATQDSIRALMM
IRTYRVRGHLQAKLDPLHLEKREDHPELDYRSYGFTDADLDRPIYIGHVLGMETATLRQI
VEVVQATYCGHVGVEFMHIQDPEQKAWIQERIEGIRNQTDFTVNGKKAMLQRLTAAEGFE
RFLQMKYTGTKRFGLEGGEVLVPALEQVMKRGGQLGLKEIVLGMAHRGRLNVLTNVMGKP
FKAVFSEFQGNAAHPEDVQGSGDVKYHLGTSSDRDFDGNTIHLSLSPNPSHLEAVNPVVC
GRVRAKQCQRAGQIPPTEESRREVMGVLLHGDAAFAGQGLVPETLLLSELKGYRTGGVIH
FIINNQIGFTTAPQYGRGGPYPTEVAKSIQAPIFHVNGDDPEAVVHIARIATEFRQKFLK
DVVVDIVCYRRQGHNEGDEPAFTQPLMYKAIRNHPTTRELYGRQLVAEGIISQPEVDGMV
QEFQQRLEQEFEAATTFRPNKADWLEGKWAGLSPATGEDRRGDTAVPLDVLKEVGLAISR
VPQGVNVNPKIVRQLKAKQEMIESGHGIDWATAEALAFGTLLVEGMPVRLSGQDVGRGTF
SQRHSVLVDQETEAKYIPLNHIRPDQAHYDVHDSPLSEAGVLGFEYGYSLAEPHALILWE
AQFGDFVNGAQAIIDQFISSGESKWLRMSGLVMLLPHGYEGQGPEHSSARLERFLQLSGE
DNWQVCNLTTPANYFHALRRQVRRDFRKPLVIATPKSLLRHKLCVSPLSQLSGSETFHRV
LGDETPDLAEAGKVRRVVLCSGKVYYDLLAEREARGVKDIAIVRIEQLYPFPAKSLGAQL
AKYPGADVVWCQEEPANMGAWFFLDRRIEGVLTEIGHKAGRPKYAGRPEAASPATGLLKR
HNQEQAKLLDEALSV
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctcgatttcgctccgtccgagcgcgactccttcctcttcggcgccaacgcc
actttcatcgctgaactctatgccaagttccagaaggacccgtcctcggtggacccgagc
tggcagtccttcttcgccgagctgggcgacgatgcggcggagctgctggcggagcttcgg
ggggcgagctggtcgagcaacgacgccggcgtgatcggcacttccgacgcggaaccggcg
gtccggccggcccgccccgccccggcggcggcgcctgcgcccgcgggctcggccgcctcg
ggcctttcggtcgatcaggtgcgccgggcgacgcaggacagcatccgcgccctgatgatg
atccgcacctaccgcgtgcgtggccatctccaggccaagctggacccgctgcacctggag
aagcgggaagaccatccggaactggactaccgctcctacggcttcaccgacgccgacctc
gaccggccgatctacatcggccacgtcctgggcatggagacggcgacgctccgccagatc
gtcgaggtggtgcaggcgacctactgcggccatgtcggcgtcgagttcatgcacatccag
gaccccgagcagaaggcctggatccaggagcgcatcgagggcatccgcaaccagaccgac
ttcaccgtcaacggcaagaaggcgatgctgcagcggctgaccgcggccgagggcttcgag
cgcttcctgcagatgaagtacaccggcaccaagcgcttcgggcttgagggcggtgaggtg
ctggtgccagcgctggaacaggtgatgaagcgcggcggccagctcggcctgaaggagatc
gtgctgggcatggcccaccgcggccggctgaacgtgctgaccaacgtgatgggcaagccg
ttcaaggccgtgttcagcgagttccagggcaacgccgcccatccggaggacgtgcagggc
tccggcgacgtcaagtaccacctgggcacctccagcgaccgcgacttcgacggcaacacc
atccacctgtcgctgtcgcccaacccctcgcacctggaggcggtgaaccctgtcgtctgc
ggccgtgtgcgcgccaagcagtgccagcgcgccggccagatcccgccgaccgaggagagc
cggcgcgaggtgatgggcgtgctgctgcacggcgacgccgccttcgccggccaggggctg
gtgccggagacgctgctgctgtcggagctgaagggctaccgcaccggcggcgtgatccac
ttcatcatcaacaaccagatcggcttcaccacggcgccgcagtacggccgcggcggtccc
tatccgaccgaggtggcgaagtcgatccaggcgccgatcttccacgtcaacggcgacgat
ccggaggcggtggtccacatcgcccgcatcgccaccgagttccgccagaagttcctgaag
gacgtggtggtggacatcgtctgctaccgccgccagggccataacgagggcgacgagccg
gcgttcacgcagcccctgatgtacaaggcgatccgcaaccatccgacgacgcgggagctg
tacggccgtcagctcgtggccgagggcatcatctcccagcccgaggtggacgggatggtg
caggagttccagcagcggctggaacaggagttcgaggcggccaccaccttccgtcccaac
aaggccgactggctggagggcaagtgggccggcctgtcccccgccacgggcgaggaccgg
cgcggcgacacggcggtgccgctggacgtgctgaaggaggtggggctcgccatctcccgc
gtgccgcagggcgtcaacgtcaatcccaagatcgtccgccagctcaaggcgaagcaggag
atgatcgagagcggccacggcatcgactgggccacggccgaggcgctggccttcggcacg
ctgctggtcgaaggcatgccggtccgcctgtccggccaggatgtgggccgcggcaccttc
tcccagcgacactccgtcctggtcgatcaggagacggaggcgaagtacatcccgctgaac
cacatccgcccggaccaggcgcactacgacgtgcatgacagcccgctgtcggaggccggc
gtgctgggcttcgagtacggctacagcctggccgagccgcacgccctgatcctgtgggag
gcgcagttcggcgacttcgtcaacggtgcccaggccatcatcgaccagttcatcagctcg
ggcgagtccaagtggctgcgcatgtcggggctggtcatgctgctgccgcacggctacgag
ggccaggggccggagcactcctccgcccggctggagcgcttcctccagctctccggcgag
gacaactggcaggtctgcaacctgaccaccccggccaactacttccacgccctgcgccgt
caggtccgccgcgacttccgcaagccgctggtgatcgccacgccgaagtcgctgctgcgg
cacaagctctgcgtctcgcccctgtcccagctctcggggagcgagaccttccaccgggtg
ctgggcgacgagacgccggatctggcggaggcgggcaaggtgcgacgggtggtgctgtgc
tccggcaaggtctattacgacctgctggcggagcgcgaggcccgcggcgtcaaggacatc
gccatcgtgcgcatcgagcagctctatccgttcccggccaagtcgctgggcgcgcaactg
gccaagtatcccggcgcggatgtcgtctggtgccaggaggagcccgcgaacatgggggcc
tggttcttccttgaccgccggatcgaaggcgtgctgacggagatcggccacaaggccggc
cggccgaaatatgcgggccggcccgaggcggcctcccccgccaccggcctgctgaagcgc
cataaccaggagcaggcgaagctgctggacgaggcgctcagcgtctga

DBGET integrated database retrieval system