KEGG   Rhodospirillum centenum: RC1_2446Help
Entry
RC1_2446          CDS       T00785                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rce  Rhodospirillum centenum
Pathway
rce00620  Pyruvate metabolism
rce00680  Methane metabolism
rce00710  Carbon fixation in photosynthetic organisms
rce01100  Metabolic pathways
rce01120  Microbial metabolism in diverse environments
rce01200  Carbon metabolism
Module
rce_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RC1_2446 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_2446 (ppc)
   00680 Methane metabolism
    RC1_2446 (ppc)
Enzymes [BR:rce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RC1_2446 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ACI99829
UniProt: B6IUK4
LinkDB All DBs
Position
2526172..2528880
Genome map
AA seq 902 aa AA seqDB search
MLNESDGVGDWPARNDVRLLGRLLGDVIRQHDGQELFDRIEAIRKASIAAHREPGVANDA
HLAAQLHALELDDMLRFVRGFLWFSLLANLAEDRQARRDATERHVPGRPDTLARAVEVLE
AKGVSRAAVAELLDHALISPVLTAHPTEVRRKSVIDREAAIGQLMQALDAAADRETRDGI
LADLYREIAILWNTRALREARITVADEIDTALSYFRATFLEVLPRLHARWEGVLGNGPLP
AFLRLGSWIGGDRDGNPNVSAATLTQALKQQARRALGHYLEELHALGGQLSICADISPPS
AELEHLAEISGDTSPHRADEPYRRALTGLYARTAATYRQLVGEAPPRSPAVPGDPYPDAA
ALLADLRVVRDSLARGSAPIVDRRLNELINAVDLFGFHLATLDLRQNADVHGRVVAELLR
VAGVEDNYLGLPEPARVALLRRELAHLRLLCNPFAGYSDETRRELEILRTLAASHERYGA
GCVRQYIVSKTSGVSNLLEVHLLLKEAGMFRPGDPPFGAVMAVPLFETIEDLAAAPLVMR
EYLGFPEIRALALSCWGFQEVMLGYSDSNKDGGYLTSNWSLHEAACALRHVFDEAGVRLQ
LFHGRGGAVGRGGGSAFAAIRAQPSGTVGGRIRITEQGEVIAAKYGNTTVGTASLETMVA
AVVLASLEPGGLREDMSRFRLAMQGMSRSAFHAYRALVYDTPGFKDFFRAATPIAEIADL
KIGSRPASRTTLDRIEDLRAIPWVFSWTQARIMLPGWYGVGTALESFPDRGLLEAMYEGW
PFLQAALSNLEMVLAKTDMDVAATYAGLVPDEALRTRVFSAIRSEWQRTHDQLLALTGQS
ELLQHAPAVARSIRLRLPYVEPLNLLQVELIRRHRAGETAPEIRDGIHLTINGIATSLRN
SG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgaatccgacggggtcggcgactggccggcgcgcaatgacgtccgactgctc
ggtcgcctgctgggcgacgtgatccgtcagcatgacggacaggagctgttcgaccggatc
gaggcgatccgcaaggcgtcgatcgccgcgcaccgggaaccgggcgtcgccaacgacgcc
catctcgccgcccagctccacgccctggaactggacgacatgctgcgcttcgtgcgcggc
ttcctctggttctcgctgctggcgaacctggccgaggaccggcaggcccggcgcgacgcc
accgagcgccatgtccccggccggcccgacacgctggcccgcgccgtggaggtgctggag
gccaagggcgtgtcgcgtgcggcggtggcggagctgctggaccacgccctgatctccccg
gtcctgaccgcgcaccccacggaggtgcggcgcaagtcggtgatcgaccgcgaggccgcc
atcgggcagctcatgcaggccctggacgccgcggccgaccgcgagacgcgggacggaatc
ctggccgacctctaccgcgagatcgccatcctctggaacacgcgcgccctgcgcgaggcg
cgcatcaccgtggcggacgagatcgacacggccctgtcctacttccgcgccaccttcctg
gaggtgctgccgcggctgcacgcccgctgggaaggggtcctgggcaacgggccgctgccg
gccttcctgcggctgggaagctggatcggcggcgaccgcgacggcaatcccaatgtttcc
gccgccaccctcacccaggccctgaagcagcaggcgcgccgggccctgggccattatctg
gaggagctgcacgccctgggcgggcagctttcgatctgtgccgacatctcgcccccctcg
gccgagctggagcatctggcggagatcagcggcgacacctcgccccaccgggccgacgaa
ccctaccggcgggccctgaccgggctctacgcccgtaccgccgccacctaccggcagctc
gtcggcgaagcgccgccacgcagccccgccgtaccgggcgacccctatccggacgcggcg
gcgctgctggccgacctgcgggtggtgcgcgattccctggcccgtgggtcggcgcccatc
gtggaccgccgcctgaacgaactgatcaacgcggtggacctgttcggcttccatctggcg
acgctggatctgcgccagaacgccgatgtccacggccgcgtggtggccgaactgctgcgc
gtcgccggggtggaggacaactatctgggcctgccggagccggcgcgggtggcgctgctg
cggcgggagctggcgcatctgcgcctgctctgcaacccgttcgccggctattccgacgag
acccggcgggaactggagatcctgcgcacgctggcggcctcgcacgagcgctacggcgcc
ggctgcgtgcgccagtacatcgtgtcgaagaccagcggcgtctccaacctgctggaggtc
cacctgctgctgaaggaggccggcatgttccggccgggcgatccgcccttcggtgcggtg
atggcggtgccgctgttcgagacgatcgaggatctggcggcggcgccgctggtgatgcgc
gagtatctcggctttccggaaatccgggccctggcgctctcctgctgggggttccaggag
gtgatgctgggctattccgacagcaacaaggacggcggctatctcacctccaactggtcg
ctgcacgaggccgcctgcgccctgcgccatgtcttcgacgaggccggggtgcggttgcag
ctcttccacggccgcggcggtgccgtgggccgcggcggcggctcggccttcgccgccatc
cgggcgcagccgtccggcaccgtcggcggccgcatccgcatcaccgaacagggcgaggtg
atcgccgccaagtacggcaacaccaccgtcggcaccgccagcctggagacgatggtggcg
gcggtcgtgctggcctcgctggagcccggcggcctgcgcgaggacatgagccggttccgg
ctggccatgcaggggatgagccgttcggccttccacgcctaccgcgccctggtctacgac
acgccgggcttcaaggacttcttccgcgccgcgacgccgatcgcggagatcgcggacctg
aagatcggctcccgcccggcctcgcgcacgacgctggaccggatcgaggatctgcgcgcc
atcccctgggtgttctcctggacgcaggcgcgcatcatgctgccgggctggtacggcgtc
ggcacggcgctggagagcttccccgaccgcgggctgctggaagccatgtacgagggctgg
cccttcctgcaggcggcgctgtcgaacctggagatggtgctggccaagaccgacatggac
gtggccgccacctatgccgggctggtgccggacgaggcgctgcggacgcgcgtcttctcc
gccatccgcagcgaatggcagcgcacccacgaccagctcctggcgctgaccgggcagtcg
gaactgttgcagcacgccccggccgtggcccggtcgatccggctgcggctgccctatgtg
gagccgctgaacctgttgcaggtcgaactgatccgccgccaccgcgcgggcgagacggcc
cccgagatccgcgacggcatccacctgaccatcaacggcatcgccaccagcctgcgcaac
agcggctga

DBGET integrated database retrieval system