KEGG   Ruminococcus champanellensis: RUM_08440Help
Entry
RUM_08440         CDS       T02600                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rch  Ruminococcus champanellensis
Brite
KEGG Orthology (KO) [BR:rch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rch01001]
    RUM_08440
Enzymes [BR:rch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RUM_08440
Protein kinases [BR:rch01001]
 Serine/threonine kinases: Other
  Bacterial family
   RUM_08440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Pkinase_fungal RIO1 Pes-10 Seadorna_VP7 Kdo FTA2
Motif
Other DBs
NCBI-ProteinID: CBL17024
UniProt: D4LBM9
LinkDB All DBs
Position
914814..917024
Genome map
AA seq 736 aa AA seqDB search
MDKNIGKKLDGRYEITELIGVGGMADVYKATDVVDHKTVAVKILKKEFAENEEFLRRFRN
ESKAIAVLSHPNIVKIYDVGFSDKIQYIVMEYIDGITLKEYMENEKVLSWKDSVHFVLQI
LRALQHAHSRGIVHRDIKPQNIMMFPDGTIKVMDFGIAKFAREQGKTATDQAIGTVHYIS
PEQARGDVTDAKSDVYSVGVMLYEMLTGKKPFDTDNPVTIAVMHMQAKAERPRNINPDIP
IGLEEIILHAMVKDPAHRYQTAQEMIRDIEQFKENPDIVFGYHDDDDEEDAQTSDSPTRF
FQAVTPATAEIPAMREGRDDQEDYEESDEDEYDDEDEEEEERRSLFVPILTGVTIAVIVA
AVILVTYLIVGWLNGDNQGDKKEFAMPNLVGTNYQEAVDAWKGKLDLKVTASEYSEYDKD
VIFYQSIPENDPIALNSVVEIKVSLGNNTIDVPDVIGWTETLATKTLSNQGLTVEVKKAA
SDTVEKGLVCETVPAAGEAIAPNSKILVYISMGPNASTVEVPNFTSKTLEEAKLDAEVMK
LELQVTEVDSSEPKGQIIFQSINAGEQVVTGTVIEVKVSNGVAPVNTCNVTFALPENVHG
SFYFTFYDGGSVFFTSPVINAEYTSGSASVPLEGSGKKELIVSVTNSSNKETARVGTYLV
DFDKKTASAKSDVNVHAAFKSIGAIAAQTEPPVVTTHPPVQHTTKPAPTHTTAEPPQPTE
PAQETEPVGDPNADQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggataagaacattggtaagaagctggacggccggtatgaaattacggagctgatcggc
gtcggcggcatggcggacgtgtacaaggccactgacgtggtggatcacaaaaccgtagcg
gtcaagatcctcaaaaaggaatttgcagagaacgaggaattcctccgcaggttccggaac
gaatccaaagccattgcagtgctgtcccatccgaatatcgtcaagatctacgatgtggga
ttctctgacaagatccagtacattgtaatggagtacattgacgggatcaccctgaaggag
tacatggagaacgaaaaggtgctcagctggaaggattccgtacactttgttctgcagatc
ctccgggcactgcagcatgctcacagcagagggatcgtacaccgggatatcaagcctcag
aatattatgatgttcccggacggcaccattaaggtcatggacttcggcattgccaagttc
gcccgggagcagggcaagaccgcaacggatcaggccatcgggacagtgcattatatcagc
ccggagcaggctcgcggcgacgtgaccgatgccaagagcgatgtatactctgtgggcgtg
atgctctatgagatgctgaccgggaaaaagccttttgatacggacaatccggtgaccatt
gcggtgatgcatatgcaggcaaaggcagagcgtccccggaacatcaatccggacattccc
atcggtctggaggagatcatcctgcatgccatggtgaaggatccggcgcaccggtatcag
actgcccaggaaatgatccgggatatcgagcagttcaaggaaaacccggacattgtgttc
ggctatcatgatgacgatgacgaggaggatgcccagacctcggattctcctacccggttc
ttccaggctgtgaccccggcaacggcggaaattccggctatgcgggagggcagagacgac
caggaggattacgaggagtccgatgaggacgaatacgacgatgaggatgaggaagaagag
gagcgccgctccctgtttgtgcccattctcaccggcgttaccattgcagtgatcgtggct
gcggtgattttggtcacctacctgatcgtaggctggctcaacggcgacaatcagggagac
aaaaaggaatttgcaatgccgaatctggtgggcaccaactaccaggaggcagtggatgcc
tggaagggcaagctggatctgaaggtgaccgccagcgaatactccgagtacgacaaggac
gtgatcttctaccagagcattccggaaaatgatcccattgccctgaacagcgttgtggag
atcaaggtgagccttggcaataacaccatcgacgtgccggatgtgatcggctggacggaa
acgcttgccacaaagaccctgtccaaccagggattgacggtggaggtcaagaaggcggcc
agcgatacagtggaaaagggactggtttgtgagaccgtgcctgccgccggggaggccatt
gcgcccaattccaagattctggtttatatcagtatgggccccaacgcttctacggtggag
gttcccaactttacaagcaaaaccctggaggaagcaaagctggacgctgaggtcatgaag
cttgagcttcaggtaacagaggtggattccagcgaacccaaggggcagatcattttccag
agcatcaatgcaggagagcaggttgtgaccggtaccgtgatcgaggtcaaggtcagcaac
ggtgttgcaccggtgaatacctgcaatgtcacatttgcactgccggagaacgtacacggc
tccttctatttcaccttctatgacgggggctccgtgttcttcacaagccctgtgattaac
gcagaatacacgtccggctctgcaagcgttcccctggagggctccggcaagaaggaactg
atcgtttctgtgaccaattcctccaacaaggaaactgcccgggtaggcacctatctggtg
gattttgacaagaagacggcaagcgcaaagagcgatgtgaacgtgcatgcggcattcaag
agtatcggtgccattgcagcacagaccgagccgccggttgtgactacacatccgccggta
cagcataccactaagccggcaccgacccataccacggcagaaccgccccagcctacggag
cctgctcaggaaacagaaccggtgggggatccgaatgcagaccaggattga

DBGET integrated database retrieval system