KEGG   Ruminococcus champanellensis: RUM_11040Help
Entry
RUM_11040         CDS       T02600                                 

Definition
(GenBank) Succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rch  Ruminococcus champanellensis
Pathway
rch00020  Citrate cycle (TCA cycle)
rch00190  Oxidative phosphorylation
rch00650  Butanoate metabolism
rch01100  Metabolic pathways
rch01110  Biosynthesis of secondary metabolites
rch01120  Microbial metabolism in diverse environments
rch01130  Biosynthesis of antibiotics
rch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RUM_11040
   00650 Butanoate metabolism
    RUM_11040
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RUM_11040
Enzymes [BR:rch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RUM_11040
    1.3.5.4  fumarate reductase (quinol)
     RUM_11040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 DAO HI0933_like GIDA Pyr_redox_3 FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CBL17257
UniProt: D4LCB2
LinkDB All DBs
Position
1212514..1214112
Genome map
AA seq 532 aa AA seqDB search
MYSKEFQESLKAVEAAREANIAYEPARMTAQEKEDLLAAYHPDYKKSEFATLQIGPNKGE
SVPHELCEMLQAHSRIQAKDVDLDNVKYDVDVLIIGGGGAGASAAIEADNAGAKTMIVTK
LRIGDANTMMAEGGIQAADKPNDSPAIHFVDAFGGGHYAAKRELLAKLVCDAPEAIHWLN
DLGVEFDKAPDGTMITTHGGGTSRKRMHAAKDYSGAEIMRTLRDEVLNRGIPVVDFTAAI
ELILDENGKAAGAVLMNMETKELMVARAKTVIIATGGAGRMHYQGFPTSNHYGATADGLV
LGYRVGAKLLYAETLQYHPTGAAFPQQIFGALVTEKVRSLGAKLVNRDGKVFMHPLETRD
VAAASIIRECSDHAEGVDTGSGLAVWLDTPMIEKIGGEGTIEKRIPAMMRMFASYGIDIR
KEPILVYPTLHYQNGGLDINVNGMTTNVENLFVAGEAVGGIHGKNRLMGNSLLDIIVFGR
SAGQNAAAAAKDTKVGKLTLDHIARFDAEREAAGISTDAVSPKLLPDYRYQK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtattcaaaggaatttcaggaatctctgaaggcagtggaagctgcaagagaagcgaat
attgcatatgagccggcgcgcatgaccgcacaggagaaggaagatctgctggcggcatac
catccggattacaaaaagagtgaatttgccacactgcagatcggccccaacaagggggaa
tccgtgccccacgagctttgcgaaatgctccaggctcacagccggattcaggctaaggac
gtggatctggacaatgtgaagtatgatgtggatgtgctgatcatcggcggcggcggcgca
ggtgcatctgctgccattgaagcggacaatgcaggcgcaaagaccatgatcgtcaccaag
ctgcggatcggcgacgccaacaccatgatggcagagggcggtatccaggctgctgacaag
cccaacgattctcctgccattcactttgtggacgcattcggcggcggtcactatgccgca
aagcgggagctgctggcgaagctggtttgcgatgcaccggaggccattcattggctcaac
gatctgggcgtagaatttgataaggcaccggacggtacgatgattaccacccacgggggc
ggtacctccagaaagagaatgcatgcggcaaaggattactccggcgctgagatcatgcgc
accctgcgggatgaggttctgaaccggggcatcccggtggtggatttcactgctgccatt
gagttgatcctggatgagaacggcaaggctgccggcgcagttctgatgaacatggagacc
aaggagctgatggttgcacgggcaaagaccgttatcattgcaaccggcggtgcgggtcgt
atgcactaccagggcttccccacctccaatcactacggcgcaactgcggatggtctggtg
ctgggctatcgtgtaggcgcaaagctgctgtatgcggagaccctccagtatcaccccact
ggcgccgcattcccccagcagatcttcggcgcactggtcaccgagaaggtgcgttctctg
ggggcgaagcttgtaaaccgggacggcaaggtgttcatgcacccactggagacccgtgat
gtggcggctgcttctattatccgggagtgttctgaccatgcagagggtgttgacactggc
agtggtctggcagtctggctggatacacccatgattgagaagatagggggagagggtacc
atcgaaaagcggatccctgccatgatgcgtatgtttgcaagctatggcattgacatccgg
aaggagccgatcctggtttatcccaccctgcactaccagaacggcggtctggacatcaac
gtgaacggcatgaccaccaatgtggagaacctgtttgtagccggtgaggctgtgggcggt
atccacggcaagaaccgtctgatgggcaattccctgctggacatcatcgtattcggacgc
agcgccggtcagaatgctgccgctgctgcaaaggatacaaaggtgggtaagctgacgctg
gatcacattgcaaggtttgatgctgagcgtgaagcagccggcatcagcacagacgctgtt
tctccgaagctcctgccggattaccggtatcaaaaataa

DBGET integrated database retrieval system