KEGG   Ruminococcus champanellensis: RUM_23860Help
Entry
RUM_23860         CDS       T02600                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rch  Ruminococcus champanellensis
Pathway
rch00970  Aminoacyl-tRNA biosynthesis
rch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rch00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RUM_23860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rch03029]
    RUM_23860
Enzymes [BR:rch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RUM_23860
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RUM_23860
Mitochondrial biogenesis [BR:rch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RUM_23860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CBL18375
UniProt: D4LFI0
LinkDB All DBs
Position
complement(2535926..2537392)
Genome map
AA seq 488 aa AA seqDB search
MDLQNTTLTQLRQLLDSKSISAAELTDAYLERIRAVDGSLLSYITVTPEEAHAQAEQAQA
RIDAGNAAPLTGIPMAMKDNLCTDGVRTTCSSRMLEDFVPPYDATVVEKLKAQNYIMLGK
ASMDEFAMGSSNQTSAFAKTRNPYDTSCVPGGSSGGSAAAVSAGLCAAALGSDTGGSIRQ
PASFCGVTGLKPTYGRVSRYGLVAFASSLDQIGPIARCARDCGTVLSAIAGQDPHDATSA
PQSVPDFNEKVGKSLKGLKIALPKEFFGDAVDDEVKEAVLAAAREYQSMGAELVDCSIST
LKYAVAAYYLIASAEAASNLARFDGIKYGLRGEGNSFDKMIRDSRSRGFGDEVKRRILLG
NYALSSGYYDAYYRKALALKQDFIKEYDRIFQNADIILTPTAPTVAYPIGKQEHDPVKMY
TGDICTVTVNIACLPAISTTCGYSRTGMPIGMSLIGRRFDEATIIQAADAFEQGFTVIPA
KPEGGAAK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggatttacagaacaccacgctgacccagttgcggcagcttctggacagcaaaagcatc
agcgctgctgaactgacggatgcgtatctggagcggatccgtgcagtggatggcagtctg
ctgtcctatatcaccgtgaccccggaggaggcgcacgcccaggcggaacaggcgcaggcc
cggatcgatgcaggcaatgctgcgcccttgacgggcatccccatggctatgaaggacaat
ctttgcaccgacggggtacgcaccacctgttcctcccggatgctggaggatttcgtgccc
ccctatgacgcaacggttgtggaaaagctgaaggcgcagaattatatcatgctgggcaag
gcaagcatggacgagtttgccatgggcagctccaaccagaccagcgcctttgccaagacc
cggaacccctatgacacaagctgtgtgcccggaggctcctccggcggcagtgcggcagcg
gtcagcgcagggctgtgcgccgctgctttgggttcggatacgggtggatccatccggcag
cctgcatccttctgcggcgtcaccggcttaaagcccacctacggcagagtgtcccggtat
ggtctggtggcattcgccagctcgctggatcagatcggccccatcgcccggtgcgcccgg
gactgcggcacggtgctgtccgccattgcgggacaggatccccacgatgccacctctgcg
ccccagtcagtgccggatttcaacgaaaaagtcggcaagtctctgaaggggctgaaaatc
gccctgcccaaggaatttttcggggacgctgtggacgatgaggtcaaggaagcggttctg
gctgctgccagggaatatcagtccatgggggcggagctggtggattgctccatttccacc
ctgaagtatgcggttgccgcatactacctgatcgcctctgcggaggcggcatccaacctt
gcccggtttgacggcatcaaatacggcctccggggcgagggaaacagctttgataaaatg
atccgggacagccggagcagaggcttcggggacgaggtcaagcgccggatcctgctgggg
aactatgccctgtccagcggctattacgacgcttactaccggaaagcccttgccctcaag
caggatttcatcaaggaatatgaccggatcttccagaacgccgatatcattctcaccccc
acggcgcctacggtggcataccccatcggcaagcaggagcatgacccggtgaagatgtac
accggagatatctgcacggtgacggtgaatattgcctgcctgcctgccatcagcaccacc
tgcggttatagcaggacggggatgcccatcggcatgtccttgatcggcagacgctttgac
gaggctaccatcatccaggcggctgacgcattcgagcagggctttactgtgatcccggca
aagccggagggaggagcggcaaaatga

DBGET integrated database retrieval system