KEGG   Methanocella arvoryzae: RCIX1323Help
Entry
RCIX1323          CDS       T00526                                 

Gene name
amyA
Definition
(GenBank) putative alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
rci00500  Starch and sucrose metabolism
rci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RCIX1323 (amyA)
Enzymes [BR:rci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RCIX1323 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Antimicrobial_9
Motif
Other DBs
NCBI-ProteinID: CAJ36612
UniProt: Q0W4T1
LinkDB All DBs
Position
complement(1613080..1614585)
Genome map
AA seq 501 aa AA seqDB search
MTRLCIGFEVHQPYRLNSGFRPGNYGGKSPEEAYFSGINREILERVCRKCYNPATALVLE
LLDQGFKCAFSLSGTLVEQLEKWEPDTLGLFEEVARHRNAEMLCQTYYHSVASLFDDPSE
FEEQVRLHRQLMRDAFGVTPAVMENTEFLFNNAIAESAKRLGFKAIYSEGVERLLGWRSP
NYVYSCRGINLLLRNYQLSDDIAFRFTNRQWPEWPLTADKYASWLAATPGDYVNVFIDYE
TFGEHQWEDTGIFEFLRWLPRECKARGVEFWKPSEIASLPAAEALNVEETVSWADVEKDI
SAWLGNTMQHMAIKEVQRGEAFASDKKTWRLLQTSDHFYYMASKFGSCGDVHSYFSPEAC
TNIEAFDMYMRVLSDFELRAAQKMKPKQVAMELRCLPPEQAFRFRTPRAYTGFSAYSLDD
FADLLNFVPEDSLQYHLSRDDYSSWIRDVLNDPGLAEDVSKCGNRIELLEVTDRRRKELW
SRLKGAGPAERRREEVWSRSR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggctttgcattggatttgaggtccaccagccgtaccggctgaactcgggattc
cggccggggaactacggcgggaaaagccctgaggaggcttactttagcggcatcaacagg
gagatccttgagcgggtctgccggaagtgctataatcccgccactgcgctggtgctggag
ctgctggatcagggcttcaagtgcgcgttcagcctttcggggacgctggtagagcagctt
gagaaatgggagccggacacgctggggctgttcgaggaggtcgcccggcaccggaacgcc
gaaatgttgtgccagacgtattaccacagcgtggccagcctgttcgacgacccctctgaa
tttgaggagcaggtgaggctgcacaggcagttaatgagagacgcgttcggcgtcacgcct
gcagtgatggagaacactgagttcctcttcaacaacgccatagcagagtcggcaaagcgt
ctcggcttcaaggcgatctactccgagggcgtggagcggctgctgggctggcgaagcccg
aactacgtgtactcctgtcggggcataaatctgctattgagaaattatcagctgtcggac
gacatcgcgttccgctttactaacaggcagtggccggagtggccgctgacggcggacaag
tacgcgtcctggctggcggcgacgccaggggattacgtgaacgtcttcatcgactacgag
acgttcggggagcaccagtgggaggacacaggcatcttcgagttcctccggtggctgccc
cgggagtgtaaagcccgtggtgtcgagttctggaagccctcggagatcgcctctttgccg
gcggcggaggcgctgaacgtcgaggagacggtgtcctgggcggacgtggagaaggacatc
tcggcgtggctgggcaacacgatgcagcacatggcgatcaaggaggtccagaggggcgag
gctttcgccagcgataaaaagacctggcggctcctgcagaccagcgatcacttctattat
atggcctccaagttcgggtcgtgcggggacgtgcactcgtacttcagcccggaggcctgc
accaacatcgaggcgttcgacatgtacatgcgggtgctctccgatttcgagctgcgggcg
gcgcagaagatgaagccgaagcaggtggcgatggagctgaggtgcctgcctcccgagcag
gctttcaggttccgcactccccgggcgtacacgggcttttcagcttatagcctggacgat
ttcgccgacctgctgaacttcgtgcctgaggactcgctgcagtaccacctgagccgggac
gactactcttcctggatcagggacgtgctgaacgatccggggctggccgaggacgtgtcg
aagtgcgggaaccgcattgagcttttagaggtgacagaccggaggagaaaggaactgtgg
agccgcctgaagggggcaggaccggcggagcggcggagggaggaagtgtggagtcgctca
agatag

DBGET integrated database retrieval system