KEGG   Methanocella arvoryzae: RCIX1966Help
Entry
RCIX1966          CDS       T00526                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rci  Methanocella arvoryzae
Pathway
rci03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rci00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    RCIX1966
Enzymes [BR:rci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RCIX1966
DNA repair and recombination proteins [BR:rci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RCIX1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CAJ37130
UniProt: Q0W3B3
LinkDB All DBs
Position
1110242..1111138
Genome map
AA seq 298 aa AA seqDB search
MTARVTTDSDRVELSHPDKVLFPEDGITKQELADYFRDVAEFMLPQVRDRPMTLQRFPNG
IGEPGFYQKEAPSYLPEWIDTVTFPLREEGREQRQILCNSAATLAYLADQGSITQHVWLS
RADRLEYPDRMIFDLDPPDDDFSIVKFAANTLRAKLKHLGIPAFPMTTGSRGLHVVVPLD
RSVDFDTVRAWAAEFARKLAWAVPDSFTTELRKESRGDRLFIDYTRNAYGQTTVAPYTVR
AKKGAPVAMPVSWEELEDLESSQAYNIRNIVKHLRETGDPWRDIDRHAGKLPALQEKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgagttaccaccgattcagatagagtcgaactctctcacccagataaagta
ctatttccagaggacggcatcaccaagcaggagctggccgattatttccgggacgtggca
gagtttatgctgcctcaggtccgggatcggccgatgaccttgcagcgtttcccgaacggc
atcggggagcccggcttctaccagaaagaggccccttcttacctgcctgagtggattgac
accgtcacctttccgctccgggaggagggccgggagcagcgccagatcctgtgcaatagc
gctgctacgctggcttatctggccgaccagggctcgattacccagcacgtctggcttagc
agggccgaccggctggagtacccggaccggatgatcttcgacctcgacccgcccgacgac
gattttagcattgtcaaattcgcggcgaacaccctccgggcgaagctgaaacatcttggc
atacccgcctttcccatgactaccggctcccgcggcctgcacgtcgtcgtcccgctcgac
aggtccgtcgacttcgatacagtcagggcatgggctgcggaattcgcccggaagctggcc
tgggcagtccccgacagcttcaccacagagctccgaaaggaaagccgcggcgacaggctg
ttcatcgactataccagaaacgcctacggccagaccaccgtcgcaccatacacagtccga
gcgaaaaagggcgcacccgtggcgatgccggtaagctgggaagagctggaagacctcgaa
tcatcgcaggcctacaacatccgcaatattgtaaagcacctcagagagactggagacccg
tggagagatatcgaccgccatgcggggaagctccctgctttgcaggagaaaaaataa

DBGET integrated database retrieval system