KEGG   Methanocella arvoryzae: RRC232Help
Entry
RRC232            CDS       T00526                                 

Gene name
trxB-1
Definition
(GenBank) NADPH:thioredoxin reductase (TrxR)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rci  Methanocella arvoryzae
Brite
KEGG Orthology (KO) [BR:rci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RRC232 (trxB-1)
Enzymes [BR:rci01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RRC232 (trxB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO HI0933_like FAD_oxidored FAD_binding_2 NAD_binding_8 GIDA Thi4 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAJ37977
UniProt: Q0W0W6
LinkDB All DBs
Position
complement(299183..300091)
Genome map
AA seq 302 aa AA seqDB search
MTFDTVVIGAGPAGLTAALYAKRKGLTLAVIADSIGGQMSKTANIENYPGHEIIPGKQLA
LIMQEQIKQLGQDIVMDRVTGVERIGNRFRTTTATGKHFDSRTLIIATGAHWREIGVPGE
KEFKNRGVSYCTTCDGPLFADMDVAVVGGANAAAESVLEMTHYATKVYMIVRSTLKADQI
LADRIMSSPKVTVLQGYTVEKITGTDFVEAIHIRSKAGEQKTLQVGGVFVEIGQDPNTDF
LKGLVKTNDKGEIIIDEYCRTSVQGIYACGDVTDVPQKQVIVAAGEGAKAAMDVYTYLST
HR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgacgtttgatacagtagtgataggtgcaggacctgcaggcctgactgcggccctttat
gcgaagagaaaaggccttaccctggccgtgatcgctgactcgatcggaggccagatgagc
aagactgccaacatagagaactatcccggccacgagatcattcccggcaagcagctggct
ttaataatgcaggagcagataaagcagttaggccaggatatcgtcatggaccgggtgacg
ggcgtcgagaggataggaaaccggttccggacaactactgcgaccggaaaacacttcgat
tcccggactctcataatcgctacaggcgcgcactggcgggagatcggcgtacccggcgag
aaagagttcaagaaccgtggtgtcagctattgtactacctgcgatgggccgctgttcgca
gacatggacgtagccgtagtcggcggagccaatgccgccgcagaatcagtgctggaaatg
actcattatgccacgaaggtatacatgatcgtccgcagcaccctcaaagcagaccagatc
ctggcagaccgtatcatgtccagtcccaaagtgaccgttctccaggggtataccgttgaa
aaaattaccggcacagacttcgtggaagccatccacatccgatcgaaggcgggcgagcaa
aaaaccctgcaggtcggcggagtcttcgtggaaatcggccaggaccccaacaccgatttc
ctcaaaggcctggtcaaaaccaacgataaaggcgaaatcatcatagacgagtactgccgc
accagcgtacaaggcatctacgcctgcggcgacgtcaccgacgtaccccagaaacaggta
atcgtagccgccggcgagggcgccaaggcagccatggatgtctacacttacctgagcaca
cacaggtga

DBGET integrated database retrieval system