KEGG   Methanocella arvoryzae: RRC34Help
Entry
RRC34             CDS       T00526                                 

Definition
(GenBank) hypothetical protein
Organism
rci  Methanocella arvoryzae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAJ37819
UniProt: Q0W1C4
LinkDB All DBs
Position
complement(464559..467939)
Genome map
AA seq 1126 aa AA seqDB search
MNKRRCISITSVLCVLITVLCATQFTGIAHSQPVYSGTYAGAGQYGGLTIQGLEGLQGFS
TGENVLSLAIQPVRQQGSQLYFQVVGFTISSPASGQAVAYALKTPIMGVADPSQNTMQID
LSYLPTAVGSAGYVNSNQIYNVLRVDPSIMVLELNMNYAGTQGLQTIFNVNAIRMITPDG
SARVFQMQQPTQLVIDAMSYRIYMVAFPQMFSVFGTFFSTPYSVLGPIVFASPILITPPI
FVPYVVPIPIVFAPVPFAFAFPSAFVTNIFTPSIFVNQFAVAAAAASAAAFGGNAAAAAS
AVASAVAGGGGAAAAAAAAAASSGAGPGGVAAAAAAAAAAATGGNVASAAAAAAAASGGA
SGASAAAAAAAAAASNGAGPGAAAAVAAASAAAAGGGNAAAAASATASALGGAGGASAAA
AAASAAAAGGPGAAAAAAAATAAAAGGGNAAAAASAAASALGGIGGASSVASAASAAASA
GVAPGGVAAAAAAAAAAAGGGDAAAAAAAASSAVGGAGGAAAAAAAASAAAAGGAGAGGA
AAAAAAAAAAASGGNAAAAASAAASAAGGGPGVSSAASAAAAAASAAGNDPGAAAAAAAA
AAAAASGGDPLRAAQTLSQSKDFGSSPGVQKVLRAAQQAKQQGIAPQQFASRLPETIKTG
VGPGGQIAGPGGRVTTPTGPGGPGAQISEPGTGRITTPGGPGGQQITGPAGRVTTPGGPG
GAQVTGPEGRVTTPGGPGGQQITGPAGRITTPSGVGGAPVTEPGTGRITTPGGPAGQQIT
GPAGRVTAPTGPGGAQIAEPGAGRVTTPSGAGQQFAQQPAQRISTPSGAGGAQQIAQPVT
GRGTTPAGAGGAQFAQQPAQRITGPSGGGGAQFTQPSGGRISAPSGGGAQFAQPAQRIST
PSGTGGAPQIAQPQRVSTPSSMGGGAQFTQPAQRISTPTGPSGGAQFAQQPAQRITGPSG
GGGAQFTQPSGGRISAPSGGGAQFAQPAQRISTPSGTGGAPQIAQPQRVSTPSSMGGGAQ
FTQPAQRISTPTGPSGGAQFAQPQRISTPSTRGGGAQFAQPAQRITTPSGPSGGAQFTQP
AQRISAPSGGGGAKFTQPASRISSPSRVSGGAPSISGGSPGSLRRR
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaacgaagatgcataagtataacttctgtattatgcgtccttatcacggtttta
tgtgctacccagtttacgggtatagctcatagtcagcccgtctactccggcacttacgcc
ggggcagggcagtacggtggattaactatccagggcctcgaaggcctgcaaggcttttct
accggtgaaaacgttttaagtctcgctatccagcctgtccggcaacagggcagccagctg
tatttccaggtggtcggttttaccatttcgagccctgcgtcgggccaggctgtggcttac
gcgctgaagacgcctatcatgggcgttgctgacccgtctcagaacacgatgcagattgat
ttgtcttatcttcccactgcggtcggatcggcaggctacgtcaacagtaatcagatctac
aacgtgctcagggtcgatccgagcatcatggtcttagagctgaacatgaattacgccggg
acccagggcttgcagaccattttcaacgtgaacgccatccgtatgatcacgcctgacgga
agcgcacgggttttccagatgcagcagccgacgcaactcgtcatcgacgcgatgtcttac
cgtatttacatggtggcgttcccgcagatgttcagtgttttcggcacgttcttcagcacc
ccgtactcagtactgggtccgatcgtctttgccagcccgatcctgattacgccgccgatc
ttcgtaccgtacgtggtgcctataccgatcgtgtttgcgccggtaccgtttgctttcgcg
tttccgagcgcgtttgtgaccaatatattcacgccatcgatcttcgtgaaccagtttgcc
gtggctgctgctgcggcatctgctgcagctttcggcggtaacgcagcggctgcagcttct
gctgtggcatctgcggtggccggtggtggcggcgcggctgctgctgcggctgctgctgca
gcttcaagcggggccgggcctggcggtgtcgctgctgcggctgctgcggctgctgctgcg
gccactggcggtaatgttgcttctgctgcggctgctgcggctgctgcatcaggaggtgca
agtggggcgtctgcggctgcggctgctgcggctgctgcggcgtccaacggcgcagggcca
ggagcagcggcagctgtagcagcagcatcggccgctgctgccggtggcggtaatgcggct
gctgcggccagcgcaacggcctctgccttaggcggtgccggtggtgcgtctgcggctgct
gctgcagctagtgcggctgctgcgggcggcccgggcgcggctgcggctgctgctgcagca
actgcggctgctgccggtggcggtaatgcggctgctgcggccagtgcagcagcgtctgca
ttaggcggcatcggtggagcatccagtgtggccagtgcggccagtgcggccgcatccgcc
ggcgtagcaccgggcggtgtagcggctgctgcggctgccgctgcggctgccgcgggtggt
ggtgatgctgcggcagctgctgcagcggcgagctctgctgtaggtggtgctggtggtgcg
gctgcggctgctgctgcggctagtgcggctgctgccggtggtgctggcgcaggtggtgcg
gctgctgcggctgcggctgctgctgctgcggccagtggcggtaatgccgcggctgcggcc
agtgctgccgcgtctgccgccggcggaggccccggcgtctcatccgctgcttcagctgcg
gctgctgccgcatctgctgcaggaaacgatcctggtgccgctgcggctgctgctgcggct
gctgcggctgctgccagcggtggtgatccgctacgggcagcccagaccctgtcccagtcg
aaagacttcggaagcagcccgggagtacaaaaagtactacgggcagcccagcaggcaaag
cagcagggcattgctccgcagcagttcgccagcaggctgcctgaaaccatcaagaccggc
gtgggtccgggcgggcagattgccggacccggcggcagagtaaccactccgacagggccg
ggcgggccgggtgcacagatcagtgagcctggcactggccggattacaactccaggcggg
cctggaggtcagcagattactggacctgccggaagagtaactacgcctggtggtcctggc
ggtgcacaggttaccggacctgaaggcagagtgaccactccgggcgggcctggaggtcag
cagattaccggacctgccggcaggattacaacgccttccggcgtcggaggtgcccctgtt
acagaaccgggcaccggtaggattactactccgggcgggccggctggtcagcagattacc
ggacctgcaggcagagtaactgctccgaccgggcccggaggagctcagatcgctgaaccg
ggtgctggtagagtaacgacgccttctggtgcgggtcagcagtttgcccagcagcctgct
cagaggattagtactccgtccggtgctggtggcgctcaacagatcgctcagccagttact
ggcagggggactacaccggcgggtgctggcggggctcagtttgcccagcagcctgctcag
aggatcactgggccttccggcggtggcggagctcaattcacacaaccttccggcgggcgc
attagtgccccgagtggtggaggggctcagtttgcgcagcctgctcagaggattagtacg
ccatcaggaactggtggcgctcctcagatcgcccagcctcagagggtaagcacaccttcg
agcatgggtggcggggctcagtttactcagcctgctcagaggatcagtacacccaccggg
ccaagtggcggggctcagtttgcccagcagcctgctcagaggatcactgggccttccggc
ggtggcggagctcaattcacacaaccttccggcgggcgcattagtgccccgagtggtgga
ggggctcagtttgcgcagcctgctcagaggattagtacgccatcaggaactggtggcgct
cctcagatcgcccagcctcagagggtaagcacaccttcgagcatgggtggcggggctcag
tttactcagcctgctcagaggatcagtacacccaccgggccaagtggcggtgcccagttt
gcgcaaccccagcgtattagcacaccatctacgagaggtggcggggctcagtttgcgcag
cctgctcagaggattactactccatccgggccgagtggtggagcccagtttactcagcct
gctcagaggattagtgctccgtccggcggaggaggagccaaatttacccagccggcgagt
agaataagctctccgtcaagagtgagcggcggagccccatccatatcgggcgggtctccg
ggcagcctgagaagacgttaa

DBGET integrated database retrieval system