KEGG   Methanocella arvoryzae: RRC496Help
Entry
RRC496            CDS       T00526                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rci  Methanocella arvoryzae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: CAJ38188
UniProt: Q0W0A5
LinkDB All DBs
Position
84663..85262
Genome map
AA seq 199 aa AA seqDB search
MPSDRNLEPYREKRQFTRTPEPYGREEAPSDKPIFVVQKHDASHLHYDFRLEVGGVLKSW
AVPKGPSVDSKVKRLAMPTEDHPLDYAGFEGTIPEGNYGAGTVMVWDTGTYSNLRETKPA
GRGHAAMEQAVTEGKIEVRLDGKKLKGNYALIRTGLQGKGWLLFKMKDEFDRPGYDIVVE
EPDSALTGRTLNEIAGTKN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcagacagaaaccttgagccttacagggaaaagcgccagttcacccgcaccccc
gagccttatggcagggaagaagctccttctgataaaccgatcttcgtcgtccagaaacat
gacgcgtcccacctccactatgatttccggctggaggtaggcggagtccttaagtcctgg
gctgttccgaaaggtccctctgtagactccaaggtcaagaggctggccatgcctactgaa
gatcaccccctcgactatgccggcttcgagggcactatcccggaaggcaactacggcgca
gggaccgtaatggtatgggataccggcacctacagcaacctgcgggagactaagcctgca
ggccgcggacatgcggcgatggagcaggctgtcacggaaggcaaaatcgaggtcaggctg
gacggtaaaaagctcaaggggaattatgcgctcatccgtactggactacaggggaaaggc
tggctgcttttcaagatgaaggacgagttcgacaggccgggatacgatatagtggtagaa
gagcctgattctgccctgaccgggcgaaccctgaacgagatcgcaggtaccaaaaactag

DBGET integrated database retrieval system