KEGG   Rickettsia canadensis McKiel: A1E_01430Help
Entry
A1E_01430         CDS       T00603                                 

Definition
(GenBank) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
rcm00473  D-Alanine metabolism
rcm00550  Peptidoglycan biosynthesis
rcm01100  Metabolic pathways
rcm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A1E_01430
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A1E_01430
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A1E_01430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rcm01011]
    A1E_01430
Enzymes [BR:rcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A1E_01430
Peptidoglycan biosynthesis and degradation proteins [BR:rcm01011]
 Precursor biosynthesis
  Amino acid ligase
   A1E_01430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABV73231
UniProt: A8EXZ8
LinkDB All DBs
Position
320438..321502
Genome map
AA seq 354 aa AA seqDB search
MHQYQIHWVEHSEVKILSNIVVRLEYKERGVKSITNRRARHDAVSESKSIDYSGKKHIAL
VAGGMSAEREVSLVSSKGVSKALIALGYKVTFIDMGADIAFKLQEIKPDIVFNCLHGTYG
EDGCLSGLLNIMRIPYTHSGVLSSALAFDKIYSRSWFLTNNINMAESIVVNKSDNIKIEP
MKRPYVIKPITQGSSIGIEVIFEEDDFNFANYDFPYGDQVIIEKYIKGRELQVAVLNGKA
LGVLEIKLLKNRFYDYETKYTEGFAEHLCPAPIPTNLYDKLLIESEKIYKTMNCKGPARV
EFLLEDQTNKLYALEINTHPGMTPLSIVPEIAAYAGINFTNLIEEIIKAASFES
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaatatcaaatacattgggtggaacattctgaagttaaaatattgagtaatata
gttgttcgacttgaatacaaggagcgaggagtgaagtctataactaataggagagcgaga
cacgatgcagtaagtgagtccaaatcaattgactatagcggtaaaaagcatatagcgtta
gtagcaggtggtatgtctgctgagcgtgaagtatctttagtgtcaagcaaaggggtaagt
aaagccttaattgcattaggatataaagtaacctttattgatatgggagcagatattgca
tttaaattacaagaaataaagcctgatatcgtttttaattgtctacacggtacatatggt
gaagacggttgtttgtcaggattacttaatataatgcggattccttatactcatagcggt
gtgttatcttcagcgttagcattcgataaaatatattctaggagctggtttttaacaaat
aatattaatatggcagaaagtattgtcgtaaataaaagcgataatataaagattgaacct
atgaaacgaccatatgtaattaagcctataacgcaaggatcaagtatcggtattgaagta
atatttgaagaagatgattttaactttgccaattatgattttccttatggtgatcaggta
ataatagagaaatatataaaagggcgagagttgcaagtagcagtattaaatggcaaagct
ttaggagttttagagattaaattactgaaaaatcgtttttatgattatgagactaaatat
actgaaggatttgctgagcatctttgtcctgctccaatacctactaatttatatgacaaa
ttacttatagaatcagaaaaaatttataaaacaatgaattgcaaaggtcctgctagagta
gagtttcttttagaagatcaaacaaataaattatatgctttggagataaatactcaccca
ggtatgactcctttgtcaatagtgccagaaattgcagcttatgcagggataaattttact
aacttaattgaagaaattataaaggcggcaagctttgaatcatga

DBGET integrated database retrieval system