KEGG   Rosa chinensis (China rose): 112180576Help
Entry
112180576         CDS       T06020                                 

Definition
(RefSeq) uncharacterized protein LOC112180576
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00061  Fatty acid biosynthesis
rcn00780  Biotin metabolism
rcn01100  Metabolic pathways
rcn01212  Fatty acid metabolism
Module
rcn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    112180576
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    112180576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rcn01004]
    112180576
Enzymes [BR:rcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     112180576
Lipid biosynthesis proteins [BR:rcn01004]
 Fatty acid synthase
  Component type
   112180576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 112180576
NCBI-ProteinID: XP_024174897
LinkDB All DBs
Position
7
AA seq 223 aa AA seqDB search
MAMSFANPYSLVVHNSTTTSHLSRISLPKSLPIHLTAKRKSGAFTAYCSAADAAKDPIKD
KDTPIELRYEAFPTVMDIHEIRESLPHRFPFLLVDRVVEYTRGGFSAVGIKNITINENFF
NGHFPGKPIVPGVLVIEAMAQLGGLILLQPELAGPCERFFLVGTDKVRFRKPVVAGDTLV
MRMTIVKMQKRLGIAKCEGRAYVGGELVCEADYLLYADKAAGY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtctttcgccaacccttattcacttgtagttcataatagtacaactacttct
catctatctagaatctctttaccgaaatctctgccgattcatttgacagctaaaaggaaa
tcaggtgctttcactgcttattgctccgccgccgacgcagcaaaagatcccatcaaggat
aaggatacccctattgaattgagatatgaagcatttcctactgtgatggatatccatgaa
attcgtgaaagtttgcctcaccggtttccatttctgttggtggatagagtggttgaatat
actcgtggaggattttcagctgtaggaatcaagaacattacgattaatgagaatttcttt
aatgggcatttccctggcaagccaattgttcctggtgttctagtgattgaggcgatggca
cagctcggtggcttgattctgctgcaaccagaactggcaggtccttgtgagagattcttt
ttggttggaactgacaaggtgcggttcaggaaaccagttgttgctggtgacacattggtg
atgagaatgactattgtcaagatgcagaaacgcttaggaatagcaaaatgtgaaggcagg
gcatacgttggaggtgaacttgtatgcgaggctgactatttgttatatgctgataaggct
gcaggttattaa

DBGET integrated database retrieval system