KEGG   Rickettsia conorii: RC0227Help
Entry
RC0227            CDS       T00061                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase e1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rco  Rickettsia conorii
Pathway
rco00020  Citrate cycle (TCA cycle)
rco00310  Lysine degradation
rco00380  Tryptophan metabolism
rco01100  Metabolic pathways
rco01110  Biosynthesis of secondary metabolites
rco01120  Microbial metabolism in diverse environments
rco01130  Biosynthesis of antibiotics
rco01200  Carbon metabolism
Module
rco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RC0227 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    RC0227 (sucA)
   00380 Tryptophan metabolism
    RC0227 (sucA)
Enzymes [BR:rco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RC0227 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N Zn_dep_PLPC
Motif
Other DBs
NCBI-ProteinID: AAL02765
UniProt: Q92J42
LinkDB All DBs
Position
complement(233978..236764)
Genome map
AA seq 928 aa AA seqDB search
MGEDFKKTGYLFGGNAVFVEELYKQYLANPASVDQTWQEFFAGIKDNNTLLNKSTAKIII
PDEIKKESLNNNLSSEDLNSLKAKEMINAYRKHAHYLANLDPLGLELRKTKNDLKLNIET
FGLDSGQLEENINITDEFVGTWNCKLSELVTKFDKVYTGSIGVEFEQIENVAGKNWLYNK
LESEVTFSSEDKKTILNDLVEVEGFEQYLHTKFPGAKRFSIEGGDASIVAMSKAIDLSMH
QGVSEIVIGMAHRGRLNTLTKVVGKPYKAVIADFISGSVFPDELNVSGDVKYHLGYSSDR
TLEDKKIHLSLADNPSHLEAVNPIVAGKVRAKQDILGDTKRSKVKAILVHGDAAFCGQGV
VAESLSMSPLAAYDIGGILHFVINNQLGFTANAADTRASRYSTEFAKIIAAPILHVNGDD
IEAVLKATNIAVEYRQKFGKDVVVEIICYRKYGHNEGDEPMYTQGKMYNIIKNKLTPGNI
YANELVKSGVIDNNYFAKLKEEFKAKLDKEYEQAKSYKQEAHFLGGLWQGISRTRTQATI
TGISKKTLHDLGTKLCEIPKDFAVNPKLVKLFEARKATLTADQPIDWATAEQLAFASLLA
SGTNIRLTGQDSGRGTFSHRHSVLHNQIDGTTYIPLNNLSKEQAKYEVADSNLSEYAVLG
FEYGYSLANPKNLVLWEAQFGDFANGAQIIFDQFISSSETKWLRMSGLVVLLPHAFEGQG
PEHSSARLERFLQLAAENNMYVTYPTTPASIFHLLRRQILDDTRKPLIVMSPKSLLRHKY
AVSKLDELGENTTFLPVLDEVTKVDTNNITKVILCSGKVYYDLFEMRGNNSNIAIIRLEQ
LYPFEKKLVASLLKKYNRTQEFIWCQEEPKNMGTWCYIVSHLNDALKEAGIKNEFKYVGR
EESASPAVGSLQVHNKQQEKLLRTALGI
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagactttaaaaaaacaggttatttatttggcgggaatgctgtttttgttgaa
gagctatataagcaatatctagccaaccctgcctcggttgatcaaacttggcaagaattt
tttgccggcattaaggataataatactttactcaataaaagtacggcaaaaataattatc
cctgatgaaataaaaaaagaatcgttaaataataatttatcttctgaagacttaaatagt
ttaaaagctaaggaaatgatcaatgcttatcgcaagcatgctcactatttagcgaatctt
gatccgcttggtcttgagctacgtaaaacaaaaaatgatttaaagcttaatatagaaact
tttggtcttgatagcggtcagctagaagaaaatatcaatattacggatgaatttgtcggt
acttggaactgtaaattatctgaattagtgaccaagttcgataaagtttatacaggttct
ataggtgtagagtttgagcaaatagaaaatgtagcaggaaaaaactggttatataataag
ctagaaagcgaagttacgttttcttctgaagacaaaaaaactatcttaaatgatttagta
gaagtagaagggtttgagcagtatttacatacaaaatttcccggagctaagcgtttttcc
attgagggtggtgatgcttctatagttgctatgagtaaagctatagatttatccatgcat
cagggcgtctcagaaatcgttatcggtatggcacatcgagggagattaaacactctaact
aaagtagtaggtaagccatataaagccgttattgcggacttcataagcggcagcgtattt
cctgatgagctaaatgtttcaggcgatgtaaaataccatttaggctattcgtccgataga
actctagaggataagaaaatacacttgtcgctagccgataacccttcacatttagaagcg
gtaaatcctatagttgcaggaaaagtaagagcaaagcaagatattcttggagatactaaa
cgcagcaaagtcaaagctattttagtgcatggcgatgctgctttttgcggtcagggcgtg
gttgccgagagtctatcaatgtcacctttagctgcttatgatatcggcgggatattgcat
ttcgtcattaataatcagttaggttttacggctaacgctgcagatactagagctagtaga
tattctacggagtttgctaaaatcatagctgccccgattttacacgttaacggtgacgat
atagaagcagtgttaaaagccaccaatattgcggtagaatacagacagaaatttggtaag
gatgttgtagtagaaattatttgttaccgtaaatatgggcataatgagggcgatgagccg
atgtatactcaaggcaagatgtataacattattaaaaacaaactgacccctggaaatatt
tacgcaaatgagttagtaaaaagcggtgtaatcgacaataattattttgctaagttaaaa
gaagaatttaaagcaaaactagataaggaatatgagcaggcaaaaagttataagcaagaa
gcacatttcttaggcggattatggcaaggtatttctcgtactcgtacacaagctacaata
acgggtatcagtaaaaaaacattacacgatttaggcactaaactatgcgaaataccgaaa
gattttgccgttaatccaaaacttgtaaaactatttgaagctcgaaaagccactctaaca
gctgatcaacctattgattgggcgacggcagagcagctagcttttgcaagcttacttgct
tcaggcacaaatataaggctaaccggacaagattcgggacgcggtactttctcgcatcgt
cattcagtattgcacaaccaaattgatggtactacctatatacctctaaataatttatct
aaagaacaagcaaaatacgaggtagccgatagtaatttatctgaatatgcggtgcttggt
tttgagtatggttattcactcgcaaacccaaaaaatttagttttatgggaagcacaattc
ggtgattttgctaatggagctcagattatttttgaccagtttatttcaagcagcgaaact
aaatggcttcgtatgagcgggcttgtggttttgttacctcatgcatttgagggacaagga
ccggagcatagttcggcaagacttgagaggttcttacaactggcagctgagaataatatg
tatgttacataccctactacccctgcttcgattttccatctgctacgtcgccaaatactt
gatgatacccgtaaaccgttaatcgtaatgtcgccgaaatcattattacgtcataaatat
gccgtatctaaacttgacgagctaggtgaaaatactactttcttaccagttttagatgaa
gtaactaaagtagatacaaacaatattactaaagtaattttatgcagcggtaaggtatat
tacgatctatttgaaatgcgtggcaataacagtaatatagcgattattaggcttgagcaa
ttatacccttttgaaaaaaaacttgtagcatcgctattaaaaaaatataataggacgcag
gaatttatttggtgtcaggaagaaccaaagaatatgggaacttggtgttatatagtttct
cacttaaacgatgctttaaaagaagcaggcattaaaaatgaattcaaatatgtaggtaga
gaggaatcagcctctccagcagtaggctcgctgcaagtacataataaacagcaagagaag
ctattaaggacagcattgggaatatga

DBGET integrated database retrieval system