KEGG   Rhodobacter capsulatus: RCAP_rcc00155Help
Entry
RCAP_rcc00155     CDS       T01213                                 

Definition
(GenBank) peptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RCAP_rcc00155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcp02000]
    RCAP_rcc00155
Transporters [BR:rcp02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    RCAP_rcc00155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 RsgA_GTPase oligo_HPY AAA_22 AAA_29 Mg_chelatase NACHT MMR_HSR1 ATPase Sigma54_activat PRK DUF87
Motif
Other DBs
NCBI-ProteinID: ADE83920
UniProt: D5AL64
LinkDB All DBs
Position
176246..177631
Genome map
AA seq 461 aa AA seqDB search
MTLLQAKDITVTAGAERLLDPVSLDLPAGRAVTVLGESGSGKSLLAQALLGTLPGGLLAG
GTLTVGETRLDPARPQGSRALWGRAIAVLPQEPWLALDPLMRGQRQVAEVHDLVAGDPAP
DDRASADLAALGLEGAGAKYPWQLSGGMAQRLAFAAARACGARITVADEPTKGLDSDRRD
DVLALLRRGLEGGGGLLTITHDLTLAAGLGGEILVMQGGTVVERGSAERVLAAPEHPYTQ
ALIAADPAHWPRPDPMPEAAPLLRAERFTVARDGRTLFAPLDFTLSPGQVLGVAGPSGCG
KSSLGNALLGLLPHQGRLWRDPAVPKLAFQKLWQDPPAAFPARITLAEGLDDLLARHRID
PARVAPLLDRLKLAPDLLARRPAAVSGGELQRIALLRALLLDLAFLFADEPTSRLDPVTQ
ALTIRLMVGIGRETGMAMVIVSHDLALLEAICDRVIRLMPG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgttgcaggcaaaagacatcaccgtgaccgccggggccgagcggctgctggac
ccggtttcgctcgatctgcccgccggtcgggcggtgacggtgctgggcgaaagcggctct
ggcaagagcctgctggcgcaggcgcttctgggcaccttgccgggcggacttttggcgggc
ggcacgctgacggtgggggagacgcggcttgacccggcccggccgcagggcagccgggcg
ctttgggggcgcgcgatcgcggttctgccgcaagagccctggctggcgctcgacccgttg
atgcgcgggcaacgtcaggtcgccgaggtgcatgatctggtggcgggcgatcccgcgccg
gacgaccgcgccagcgccgatctggcggcgctgggactggagggggcgggggcgaaatac
ccctggcagctttcgggcggcatggcgcaacggctggcctttgcggcggcgcgggcgtgc
ggggcgcggatcaccgtggccgacgagccgaccaaggggctcgacagcgaccggcgcgat
gacgtgctggcgctgttgcggcgcgggcttgagggcggcggcgggcttttgacgatcacc
catgatctgacgctggcggcaggcctgggcggcgagatcctggtgatgcagggcggcacg
gtggtcgaacgcggctcggccgaacgggtgctggcggcgcccgaacatccctatacgcaa
gcgctgatcgccgccgatccggcgcattggccgcgccccgatccgatgcccgaggccgcg
ccgctgctgcgggccgagcgtttcacggtggcgcgcgacgggcgaaccctgtttgcgccg
ctcgatttcaccctttcgcccgggcaggttctgggcgtggcggggccgtcgggctgcggc
aagtcgagccttggcaatgcgcttttggggcttttgccgcatcagggcaggctgtggcgg
gacccggcagtgccgaaacttgcctttcagaagctctggcaggatccgcccgccgccttt
ccggcgcggatcacgctggccgaggggctggacgacctgctggcgcggcatcggatcgat
ccggcaagggtggccccgctgctcgaccggctgaagctggcgcccgatcttctggcgcgc
cgacctgcggcggtgtcgggcggcgagttgcagcgcatcgcgcttttgcgggcgttgctg
ctggatctcgcgttcctgttcgccgacgagcccacctcgcggctggatccggtgacgcag
gcgctgacgatcaggctgatggtcgggatcggccgcgagaccggcatggcgatggtgatc
gtcagccatgaccttgccctgctcgaggcgatctgtgaccgggtgatccggctcatgccg
ggctga

DBGET integrated database retrieval system