KEGG   Rhodobacter capsulatus: RCAP_rcc00579Help
Entry
RCAP_rcc00579     CDS       T01213                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00630  Glyoxylate and dicarboxylate metabolism
rcp00710  Carbon fixation in photosynthetic organisms
rcp01100  Metabolic pathways
rcp01120  Microbial metabolism in diverse environments
rcp01200  Carbon metabolism
Module
rcp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rcp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rcp_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RCAP_rcc00579 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RCAP_rcc00579 (cbbL)
Enzymes [BR:rcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RCAP_rcc00579 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADE84344
UniProt: O32740
LinkDB All DBs
Position
complement(619881..621302)
Genome map
AA seq 473 aa AA seqDB search
MAAKTYDAGVKDYRSIYWEPQYQVKDSDILAVFKVVPQPGVSREEAAAAVAAESSTATWT
TVWTDLLTDLDYYKGRAYAIEDVPGSDEAFYAFIAYPMDLFEEGSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPLWFVMTCPGAPHGMKVERDLLDKYGRPLLGCTIKPKLGLAAKNYGR
AVYECLRGGLDFTKDDENVNSQPFLRWRDRFLFCQEAIQKAEAETGERKGHYMNVTAGTM
EEIYERAEFAKEIGTPIIMSDYLTVGWAAHTSLSRWCRKNGMLLHVHRAMHAVMDRNPNH
GINFRVLAKILRLMGGDHLHSGTVVGKLEGDREATIGWINLLRDRFIKADRSRGIFFDQD
WGPQPGLFPVASGGIHVWHMPALVSIFGNDSVLQFGGGTLGHPWGNAAGACANRVALEAC
VQARNEGRHLEKEGKEILTKAAQSSPELRMAMETWKEIKFEFDTVDKLDVQHR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaagacctatgacgccggtgtcaaagactaccgctcgatctattgggaaccg
caatatcaggtgaaggacagcgacattctggccgtcttcaaggtggtgccgcagccgggc
gtcagccgcgaggaagccgccgccgccgtcgccgccgaaagctccaccgcgacctggacg
acggtctggaccgaccttctgaccgatctcgattactacaagggccgcgcctatgcgatc
gaggatgtccccggcagcgacgaggccttttatgccttcatcgcctatccgatggacctg
ttcgaggaaggctcggtcgtcaacgtcttcacctcgctcgtcggaaacgtctttggtttc
aaggcggtgcgggcgctgcggctggaagacgtgcggtttccgctctggttcgtgatgacc
tgccccggggcgccgcacgggatgaaggtcgagcgcgaccttctggacaaatacggccgc
ccgctgctgggctgcacgatcaagccgaaactgggtcttgcggccaagaactacggccgg
gcggtctatgaatgcctgcgcggcgggctggatttcaccaaggatgacgagaacgtcaac
agccagcctttcctgcgctggcgcgaccgcttcctgttctgtcaggaggcgatccagaag
gccgaggccgaaaccggcgagcgcaagggccattacatgaacgtcaccgccgggacgatg
gaggagatctacgaacgcgcggaattcgccaaggaaatcggcacgccgatcatcatgtcg
gattatctgaccgtcggctgggcggcgcatacgagcctgtcgcgctggtgccgcaagaac
gggatgctgctgcatgtccaccgcgccatgcatgcggtgatggaccgcaaccccaatcac
ggcatcaacttccgggtgctggcgaagatcctgcggctgatggggggcgatcacctgcat
tcgggcaccgtcgtcggcaagctcgagggcgaccgcgaggcgacgatcggctggatcaac
cttctgcgcgatcgcttcatcaaggccgaccggtcgcgggggatctttttcgatcaggac
tgggggccgcagccggggctgttcccggtggcttcgggcggcatccatgtctggcacatg
ccggcgctggtctcgatcttcggcaatgactcggtgctgcaattcggcggcggcacgctg
ggccacccctggggcaatgccgcgggcgcctgtgcgaaccgggtggcgctggaggcctgc
gtgcaggcccgcaacgagggccgccatctggaaaaggaaggcaaggagatcctgaccaag
gccgcgcaatcgagccccgagctgcgcatggcgatggagacctggaaagagatcaagttc
gaattcgacaccgtcgacaagctcgacgtgcagcaccgctga

DBGET integrated database retrieval system