KEGG   Rhodobacter capsulatus: RCAP_rcc01634Help
Entry
RCAP_rcc01634     CDS       T01213                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00061  Fatty acid biosynthesis
rcp00780  Biotin metabolism
rcp01100  Metabolic pathways
rcp01212  Fatty acid metabolism
Module
rcp_M00083  Fatty acid biosynthesis, elongation
rcp_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RCAP_rcc01634 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RCAP_rcc01634 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rcp01004]
    RCAP_rcc01634 (fabZ)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RCAP_rcc01634 (fabZ)
Lipid biosynthesis proteins [BR:rcp01004]
 Fatty acid synthase
  Component type
   RCAP_rcc01634 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ADE85379
UniProt: D5ATU0
LinkDB All DBs
Position
1767615..1768076
Genome map
AA seq 153 aa AA seqDB search
MSEPAPYTSADLSLIKRIIPHRYPFLMVDKVRDIVPFESAVGIKCVTNNEPQFTGHFPEE
PVMPGVMIVEAMAQTAAVVVGISMNVIDKPLGTYFMAIDGCKFRRKVVPGDVLEMHVTVK
RGGGKVWKFLGESFVEGQLAATAEFTAMMDLKG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacccgccccctataccagcgccgatctgagcctgatcaagcggatcatcccg
caccgttaccctttcctgatggtcgacaaggtgcgcgacatcgtgcctttcgaaagcgcg
gtggggatcaaatgcgtgaccaacaacgagccgcaattcaccggccatttccccgaggaa
ccggtgatgccgggggtgatgatcgtcgaagccatggcgcagacggcggcggtggtcgtg
ggcatttcgatgaacgtgatcgacaagccgcttggcacctatttcatggcgatcgacggc
tgcaagttccgccgcaaggtggttccgggcgacgttcttgaaatgcatgtcacggtcaag
cgcggcggcggcaaggtgtggaaattccttggcgaatcctttgtcgaggggcagctggcg
gcgaccgccgaattcaccgcgatgatggatctgaagggctga

DBGET integrated database retrieval system