KEGG   Rhodobacter capsulatus: RCAP_rcc02516Help
Entry
RCAP_rcc02516     CDS       T01213                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00240  Pyrimidine metabolism
rcp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RCAP_rcc02516 (tdk)
Enzymes [BR:rcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RCAP_rcc02516 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ADE86246
UniProt: D5AMH0
LinkDB All DBs
Position
2701352..2701942
Genome map
AA seq 196 aa AA seqDB search
MAKLYFHYSTMNAGKSTALLQASYNYIERGMQTLLVTARLDDRAGPGKIGSRIGISAAAT
CFTPQTDMFDLCKNRLISGPCACVFIDESQFLTEAQVWQLARVVDDLGLPVMCYGLRVDF
RGQLFPGSAALLALADEMREVRTICHCGKKATMVVRMGPDGQALHEGAQVQIGGNETYVS
LCRRHWREAMGDGPQA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttacttccattactcgacgatgaatgccggcaagagcaccgcgcttttg
caggcctcctacaactacatcgaacgcggcatgcagaccctgctggtcacggcgcgtctg
gatgaccgggccgggccgggaaagatcggcagccgcatcggcatctcggccgcggcgacc
tgtttcaccccccagaccgacatgttcgatttgtgcaagaatcggctgatctcgggcccc
tgcgcctgcgttttcatcgacgaatcacaattcctcaccgaggcgcaggtctggcagctg
gcccgggtcgtggatgatctggggctgccggtgatgtgctacgggctgcgcgtcgacttt
cgcggccagctgttcccgggctctgcggcgctgcttgcgctggccgacgagatgcgcgag
gtccgcaccatctgccattgcggaaagaaggcgacgatggtggtgcggatggggcccgat
ggccaggccctgcacgagggcgcgcaggtgcagatcggtggcaacgagacctatgtctcg
ctctgtcgtcgccactggcgcgaagccatgggcgacggcccgcaagcttga

DBGET integrated database retrieval system