KEGG   Rhodococcus coprophilus: NCTC10994_02133
Entry
NCTC10994_02133   CDS       T06666                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rcr  Rhodococcus coprophilus
Pathway
rcr00250  Alanine, aspartate and glutamate metabolism
rcr00410  beta-Alanine metabolism
rcr00640  Propanoate metabolism
rcr00650  Butanoate metabolism
rcr01100  Metabolic pathways
rcr01120  Microbial metabolism in diverse environments
Module
rcr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCTC10994_02133 (gabT2)
   00650 Butanoate metabolism
    NCTC10994_02133 (gabT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCTC10994_02133 (gabT2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCTC10994_02133 (gabT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rcr01007]
    NCTC10994_02133 (gabT2)
Enzymes [BR:rcr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NCTC10994_02133 (gabT2)
Amino acid related enzymes [BR:rcr01007]
 Aminotransferase (transaminase)
  Class III
   NCTC10994_02133 (gabT2)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: SQI32395
UniProt: A0A2X4WZD9
LinkDB
Position
1:complement(2335055..2336296)
AA seq 413 aa
MARLSPLLLQATPVTVDHASGCYLYDSEGRRYLDFTAGIGVTSTGHCHPHVVEAARRQAG
TLIHGQYTTVMHRPLLELVDALGPVLPEGLDSLFFANSGSEAVEAALRLVRQATGRPNVV
VFHGGFHGRTVAAASMTTSGTRFSAGFSPLMGGVHIAPFPTAYRYGWSEDEATDFALREL
DYLFTTVTAPDETAAFVVEPVLGEGGYVPGNTRFFQGLRERADRYGILLVFDEIQTGFGR
TGKFFGHQHFGVRPDVITMAKGLASGFPLSGIAASEELMSRARPGSQGGTYGANAVSCAA
AVATLEVIEKEGLVANAAARGTELLAGAHERATVAVGDVRGLGLMVGSEFVDTDGAPDRD
RATAAQQAAARKGLLLLTCGPYMNVVRMIPPLIVTGEQTEEALDIWSEVLAEV
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggcacgactgtcaccacttcttcttcaagccaccccggtcaccgtcgaccacgcgtcc
ggttgctacctgtacgacagtgaggggcgccgctacctcgatttcaccgcaggcatcggt
gtcacgagtaccgggcactgtcatccgcatgtcgtcgaggcggcgcggcggcaagccggc
accctgatccacggtcagtacacgaccgtcatgcaccggcccctgctcgaactcgtcgac
gcactcggtccggtgctgcccgaaggtctcgattccctcttcttcgccaattccggaagc
gaagccgtcgaagccgcgctgcgtctggtccggcaagcgacgggtcgccccaacgtggtc
gtcttccacggcgggttccacggccggacggtcgctgccgcctccatgacgacttcgggt
acccggttctcggccggcttctccccgctgatgggaggtgtgcacatcgcaccctttccc
accgcctaccggtacggctggagtgaggacgaggcaacggatttcgcgttgcgagagctg
gactacctgttcacaacggtcaccgcgcccgacgaaaccgcggcattcgtcgtcgaaccc
gttctcggcgagggtggttacgtccccggaaacacgcgcttcttccagggcctgcgggag
cgcgccgacagatacggcatcctcctcgtcttcgacgagatccaaaccggattcggacga
accggaaagttcttcggacaccagcacttcggcgttcgtccggacgtgatcacgatggcg
aaggggctcgcgagcggatttcccctgtccgggattgcggcgtcggaagaactgatgtcg
cgtgcccgcccgggatcgcagggtggcacctacggagccaatgcggtctcgtgcgcggcg
gcggtggcgaccctcgaggtgatcgagaaggaaggacttgtggcgaatgcggcggcccgg
ggtaccgaattgctggcgggtgcgcacgagcgggcgacggtcgcagtcggtgacgtccga
ggactcggcctcatggtgggatccgaattcgtcgatacggacggcgcccccgaccgcgat
cgcgcgacggctgcgcaacaggctgccgcacgaaaaggcttgttgctgttgacatgcggt
ccctacatgaacgtggtacgcatgatcccaccgttgatcgtgacaggagagcagacggag
gaggcgctcgatatctggtcggaggttctcgccgaggtctga

DBGET integrated database retrieval system