KEGG   Ricinus communis (castor bean): 11542325Help
Entry
11542325          CDS       T01087                                 

Gene name
rbcL, RCOM_ORF00051
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00630  Glyoxylate and dicarboxylate metabolism
rcu00710  Carbon fixation in photosynthetic organisms
rcu01100  Metabolic pathways
rcu01200  Carbon metabolism
Module
rcu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rcu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rcu_M00532  Photorespiration
rcu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    11542325 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    11542325 (rbcL)
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     11542325 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 11542325
NCBI-ProteinID: YP_005090186
UniProt: G1D766
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREAGKWSPELAAACEVWKEIKFEFPAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttgggttcaaggctggtgttaaagattat
aaattgacttattatactcctgaatatgaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaacctggagttccgcctgaggaagcaggagctgcagtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagtcttgatcgttat
aaaggacgatgctaccacattgagcccgttgccggagaagaaaatcaatttattgcttat
gtagcttaccccttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtatttgggttcaaagccctacgcgccctacgtctggaggatttgcgaatc
cctcctgcttatacaaaaactttccaagggccgcctcatggcatccaagttgagagagat
aaattgaacaagtatggtcgccctctattgggttgtactattaaacctaaattggggcta
tccgctaagaattacggtagagcagtttatgaatgtctacgcggtggacttgattttacc
aaagatgatgagaacgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaagcacaggctgaaacaggtgaaatcaaaggacattatttg
aatgctactgcaggtacatgcgaagaaatgatcaaaagggctgtatttgccagagaatta
ggagttcctatcgtaatgcatgactacttaacagggggattcactgcaaatactaccttg
gctcattattgccgagataatggtttacttcttcacattcaccgcgcaatgcatgcagtt
attgatagacagaagaatcatggtatgcattttcgtgtactagctaaggcgttacgtatg
tctggtggagatcatattcacgctggtaccgtagtaggtaaacttgaaggggaaagagac
atcactctgggctttgttgatttattgcgtgatgattttattgaaaaagatcgaagccgc
ggtatttatttcactcaagattgggtctctctacctggtgttctgcctgtagcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggagatgattccgtacta
caattcggtggaggaactttagggcacccttggggaaatgcacccggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgcgag
ggtaatgaaattatccgcgaagctggcaaatggagtcctgaattagctgctgcttgtgaa
gtatggaaggagattaaatttgaattcccagcaatggatactttgtaa

DBGET integrated database retrieval system