KEGG   Ricinus communis (castor bean): 8258740Help
Entry
8258740           CDS       T01087                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00250  Alanine, aspartate and glutamate metabolism
rcu00410  beta-Alanine metabolism
rcu00430  Taurine and hypotaurine metabolism
rcu00650  Butanoate metabolism
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Module
rcu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    8258740
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    8258740
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    8258740
   00430 Taurine and hypotaurine metabolism
    8258740
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     8258740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 8258740
NCBI-ProteinID: XP_015580431
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MALSKAGLDTDVSIHSTFASRYVRTCLPRFKMPQNSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNRRKAEGKPYDSPNIVTGANVQVCWEKFARYFEVELKE
VKLRENYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKKTGWNTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWIIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNVMENCRDNMLVLKEGLEQ
TGRFNIVSKDIGVPLVAFSLKDNSQHNEFELTDLLRRYGWIIPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLLNDVQKVLHELDSLPSKLLSKVSICGDDDNNVVVKKTALETQREVTM
VWKKFVMEKKKMNGVC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggctctctctaaggctggtttagacacagatgtctctattcattctacattcgcctct
cgatatgtccgaacttgtcttcccaggttcaagatgccacaaaattccattcctaaagag
gcagcttaccaaatcattaatgacgagctaatgttggatggaaatccaaggcttaacctg
gcatcctttgttactacatggatggagcctgagtgcgataagcttatcatgtcttccgtc
aataagaactatgttgacatggatgagtatcctgtcaccactgaattgcagaatcgatgt
gtcaacatgatagcacatctttttaacgcaccacttggagactcagagactgcagttgga
gtagggactgttggatcttcagaggcaataatgcttgctggattagcatttaagagaaag
tggcagaacaggagaaaagccgagggaaagccttatgatagtcccaacattgtaaccggt
gccaatgttcaggtctgctgggagaaatttgcaaggtactttgaggtggagctgaaagag
gtgaagctaagggagaactattatgtaatggaccctgaaaaggcagtggaaatggttgat
gaaaacacaatctgcgtagctgctattcttggctctactttaaatggagaatttgaagat
gtcaagctcttgaatgatcttttggttgagaagaacaagaaaactggatggaatactcca
attcatgtggatgcagcaagtggtgggtttattgcaccttttctttacccagagcttgag
tgggattttagattgccattagtgaagagcattaatgttagtggccataaatatggactt
gtttatgctgggattggttggatcatttggaggagcaaagaagacttgcctgaagagctc
atcttccatattaattatcttggagctgatcagcctactttcaccctcaatttctccaaa
ggttctagtcaagtcattgctcagtactatcaactaatccgtttgggttttgagggatac
aaaaacgtaatggagaactgtagagacaacatgctagtcctgaaagaaggattggagcag
acaggacgtttcaacatcgtgtcaaaagatattggggtaccactggtagcattttctctg
aaagacaacagccaacacaatgagttcgagcttactgatttactgaggcggtatggctgg
atcattccagcctacaccatgcccccagatgcccaacacgttaccgtgctgcgggtggtg
ataagggaagacttctctcgcaccctagcagaacgccttctcaatgacgtccagaaagtg
ttgcatgagcttgattctttaccgtctaaacttctgagtaaggtttccatttgcggagat
gatgataacaatgtcgtcgtcaagaaaactgcgttagagacccaaagggaagtgactatg
gtttggaagaagtttgtcatggaaaagaagaaaatgaatggtgtttgttaa

DBGET integrated database retrieval system