KEGG   Ricinus communis (castor bean): 8258742Help
Entry
8258742           CDS       T01087                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00250  Alanine, aspartate and glutamate metabolism
rcu00410  beta-Alanine metabolism
rcu00430  Taurine and hypotaurine metabolism
rcu00650  Butanoate metabolism
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    8258742
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    8258742
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    8258742
   00430 Taurine and hypotaurine metabolism
    8258742
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     8258742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC GST_C_6
Motif
Other DBs
NCBI-GeneID: 8258742
NCBI-ProteinID: XP_002528515
UniProt: B9SR96
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRASLPRFKMPESSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPVKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLTEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKDDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNIMENCRDNMLVLKDGLEK
TGRFTIVSKDNGVPLVAFSLKDNSSHNEFEISELLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTFAERLVLDIEKVLHELDTLPSRLREKIAIVEEKEKNGTKAAKKSVIETQREI
TTIWKKFVLEKKKMNGVC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaaacagcttccgaatccgacgtctccgttcactcaaccttcgcttcc
cgatatgttcgagcttcacttcctcggtttaagatgccggagagctcgatcccaaaagaa
gcagcttaccagataataaacgatgagctaatgttagacggaaatccaagattgaatttg
gcgtcatttgtgactacttggatggaacctgagtgtgataagcttataatggcttctatc
aacaaaaactatgtcgacatggatgagtaccctgtcactactgaattgcagaaccgatgt
gttaatatgatagcacatctctttaacgcaccacttggagattcagagactgcagttgga
gtaggaacagtaggatcttcagaggctataatgttggctggattagcattcaagagaaag
tggcagaacaagagaaaagctgagggaaagccctatgataagcctaacattgtcactggt
gccaatgttcaggtttgttgggagaaatttgcaaggtattttgaagtggagttgaaggaa
gtgaaacttagagatgggtactatgtgatggatcctgtgaaagcagttgaaatggttgat
gagaacacaatctgcgtcgctgctattcttggttccacccttaatggagaatttgaagat
gtaaagctcttgaatgatctcttgacagagaaaaacaagcaaactggatgggatactcca
atacatgttgatgcagcaagtggtggatttattgcaccttttctttacccagaacttgag
tgggatttcagattgccattggtgaagagtatcaatgttagtgggcacaaatatggacta
gtctatgctggaattggttgggtcatttggaggaacaaagatgacttgcctgatgaactc
atcttccatatcaactatcttggagctgatcaacctaccttcaccctcaatttctccaaa
ggttctagccaagtcattgctcagtactatcaactcattcgcttgggttatgagggatac
agaaacattatggaaaattgcagagacaacatgctggttctcaaggacggactagagaag
acagggagattcaccattgtctcaaaggataatggtgtaccactagttgcattttccctg
aaagacaacagcagccataacgagttcgagatttctgaattgctaaggaggtttggctgg
attgttcctgcatacacaatgccacctgatgctcaacacgttactgtcctccgtgttgtg
attagagaagatttttcgcgcactttcgcagagcggcttgttcttgatattgaaaaggtt
ctgcatgagcttgatactcttccttccaggctccgtgaaaagattgctattgttgaagag
aaagaaaagaatggaacaaaggcagcaaagaagagtgttattgaaacgcaacgggagata
acaactatttggaaaaagtttgtcttggagaagaagaagatgaatggtgtttgttag

DBGET integrated database retrieval system