KEGG   Ricinus communis (castor bean): 8261764Help
Entry
8261764           CDS       T01087                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00052  Galactose metabolism
rcu00500  Starch and sucrose metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    8261764
   00500 Starch and sucrose metabolism
    8261764
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     8261764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 SH3_7
Motif
Other DBs
NCBI-GeneID: 8261764
NCBI-ProteinID: XP_002534242
UniProt: B9T7M3
LinkDB All DBs
Position
Unknown
AA seq 935 aa AA seqDB search
MNRGIPTTSLLLISLPKRFTEMVRHNIKPTLSYSHHLLLLLFPILFLSYWIPLLSGQEYE
AVGHGYTIDSVTINLPDKSLKADLSLIRNSSIYGTDIQSLNLLASFETKERLRIRITDSK
TQRWEIPQDIIPRPTHPSTLKTLSVEESPATHRALYENRILSTPTSDLVFTLHSTTPFGF
SVSRKSNGDVLFDASPDTGDPGTFLVFKDQYLQLSSSLPKDRSNLYGIGEHTKSSFRLQP
NQTLTLWNADIGSSVQDVNLYGSHPFFLDVRSPSGDGRMPPGSSHGVLVMNSNGMDIVYG
GDRISYKIIGGVIDLYIFGGPSPDMVIQQYTELIGRPAPMPYWSFGFHQCRYGYKNLSDV
ESVVAGYEKAGIPLEVMWTDIDYMDAYKDFTFDPVNFPADQMKQFVDKLHQNGQRYVVII
DPGISLNDSYGTYTRGMEADVFIKRDGVPYLGEVWPGPVYFPDFLKPDTNTFWRDEIKRF
RDIVPVDGLWIDMNEISNFITSPPTPSSTLDDPPYKINNAGNQRPINNKTTPATCLHFGS
ITEYDVHNLYGLLEARATHDALIDVTGKRAFVLSRSTFVSSGKYTAHWTGDIASTWVDLA
NTIPTMLNFGLFGISMVGADICGFSGNTSEELCRRWIQLGAFYPFARDHSDKFSIRQELY
LWDSVAATARKVLGLRYRLLPYFYTLMYEAHTRGTPIARPLFFSFPEDVNTYEISFQFLI
GKGVMVSPVLEGGESSVDAYFPKGNWFSLFNYSNSVSSSPGKYVTLDAPADEINVHVKEG
NILAMQGEAMTTEAARKTPFELLVVVSSNGCNSSGELFLDGGEDVGMGELGGKWSFLRFY
GGSRGNSLFVSSEIENGSFALSQKWIINKVTFIGLAKARKLKAHQVHITKGYKLSGKHPV
VETSLDRNGQFGSIEVSGLSILIGEAFNLDVNLMQ
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaggcatacccactaccagtctgctactaatttccttacctaaaagattcaca
gaaatggtaaggcacaacattaagccaacactatcttactctcaccatctcctacttctc
ctcttccccatcttgtttctctcttactggattccattattgagtggacaagaatatgaa
gctgttgggcatggctacacaattgactctgttactattaatctaccagacaagtctttg
aaagctgatcttagccttatcaggaattcctctatttatggaactgatattcaaagtctc
aatcttttggccagctttgaaacaaaagaacgtctcagaatcagaataacagattccaaa
acacagagatgggagatcccacaagatatcattccccgtccaacccatccttccaccctg
aaaaccctttctgtcgaagaatctccggcgacccaccgtgccttgtacgaaaacagaatc
ctctccacccccacatcagacctcgttttcaccctccacagcacgacgcctttcggcttc
tccgtgtcccggaaatccaacggggacgtacttttcgacgcgtcgccggacacgggggat
cccggcacgttcttggtctttaaggatcaatatctacagctctcttcttcgctccccaaa
gacaggtctaacctttatggaattggggagcacacaaagagctctttcaggctgcagcct
aatcagacgttgactttgtggaatgctgacattggaagttctgtccaggatgttaatctc
tatggttcccacccgtttttcttggacgtccgatcaccgtcaggggacgggagaatgccg
ccggggagcagccacggtgttctggtgatgaacagtaacgggatggatatagtttacggc
ggcgacaggataagttacaagataatcgggggtgttattgatctgtatatttttggtggg
ccgtctccggatatggttatacaacagtacacagagctcattggtcggcctgcgcctatg
ccttactggtcatttgggtttcaccagtgccgatatggttacaagaacctttcagatgtt
gagtcagtggttgctggctatgaaaaagctggtatccctcttgaagttatgtggactgat
attgattacatggacgcatataaggatttcacttttgatcctgtcaactttcctgccgat
caaatgaaacaatttgttgacaagcttcatcagaatggtcaaagatacgtcgtcattatt
gatcctggtatcagtctgaatgatagctatggaacctataccagagggatggaagccgat
gtctttattaaacgtgatggtgtgccttacttgggagaagtttggccaggacctgtctac
tttcctgattttctaaaacctgacaccaacaccttctggagagatgagatcaaaaggttc
agagacattgttcctgtagatggtctttggattgacatgaatgagatttccaatttcata
acttcaccaccaactccatcctctacccttgatgatcccccttacaagattaacaatgca
gggaaccaaaggccgattaacaataagacaacaccagcaacatgtctacattttggcagc
attacagaatatgatgtccacaacttatatggactgctagaagctagagcaacacatgat
gctctaatagatgtgactggcaagagggcttttgtgcttagtagatccacttttgtaagc
tctggcaagtacacagctcactggactggagacattgcctccacatgggttgatttggcc
aacaccattcccaccatgctgaactttggactctttggcatatcaatggttggtgctgac
atatgtggtttttctgggaatactagtgaagaactctgccgtcgttggattcagttgggt
gcattttatccctttgcaagagatcactcggataaattcagtattcgtcaagagctttat
ctatgggattcagttgctgcaactgcaaggaaagtgctggggctgcgttatcggttactt
ccatacttctacacactaatgtacgaggcacataccagaggaacacctatagcaaggccc
cttttcttctcattccctgaagatgtcaacacttacgagatcagtttccaatttctgatt
ggtaagggtgtgatggtttcgccagtgctcgagggaggagaatcatcggttgatgcatac
ttccctaaaggaaactggttcagtctgttcaattactctaattctgtaagctcaagccca
ggaaagtacgtgacactcgatgcaccagctgacgagattaatgtgcatgtcaaagaaggt
aatattctggcaatgcaaggggaagcgatgacaacagaagctgctcgaaagacgccattc
gagctcctggttgttgtgagcagcaatggatgcaatagttctggtgaattgttcttggat
ggtggagaggatgtggggatgggcgaacttggagggaaatggagtttcctccgattttat
ggtggaagtagagggaattctctatttgtttcatcagaaattgagaatggaagtttcgct
ttgagccagaaatggatcatcaataaggtaactttcattgggttggcaaaggcccggaaa
ttgaaagcacatcaggttcacattacaaagggatacaagttgagtggcaagcaccctgtt
gtggagactagcttggacagaaatggacagtttggtagcattgaagtttcaggattatca
attctgataggagaggcgtttaacttggatgtgaatctcatgcaatga

DBGET integrated database retrieval system