KEGG   Ricinus communis (castor bean): 8265013Help
Entry
8265013           CDS       T01087                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu03030  DNA replication
rcu03410  Base excision repair
rcu03420  Nucleotide excision repair
rcu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    8265013
   03410 Base excision repair
    8265013
   03420 Nucleotide excision repair
    8265013
   03430 Mismatch repair
    8265013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rcu03032]
    8265013
   03400 DNA repair and recombination proteins [BR:rcu03400]
    8265013
Enzymes [BR:rcu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     8265013
    6.5.1.6  DNA ligase (ATP or NAD+)
     8265013
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     8265013
DNA replication proteins [BR:rcu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    8265013
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     8265013
DNA repair and recombination proteins [BR:rcu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     8265013
   NER (nucleotide excision repair)
    Other NER factors
     8265013
   MMR (mismatch excision repair)
    Other MMR factors
     8265013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL UBA_4
Motif
Other DBs
NCBI-GeneID: 8265013
NCBI-ProteinID: XP_015580202
LinkDB All DBs
Position
Unknown
AA seq 1379 aa AA seqDB search
MESSTSQSSKRPPFKILNSLSLYQTSLSSLSLSLPSQFPPLPPSLPLSKHIPKTRFLIDA
FRFSTAAAAYFLTHFHSDHYSGLSSNWSQGMIFCSQITANLVTRILNVPSQFVYPLPLND
TVIIDGSEITLIDANHCPGAVQLLFKVRSSGTFEMYVHTGDFRYSREMKEVGILRDFVGC
DAVFLDTTYCNPKFVFPKQQESIDYVVSVIERIGGDFQAMSKRVLFLVATYVVGKERILI
EIAKRCRRKVHVDRRKMEVLRVLGYGESGVFTEDEGQSDVHVVGWNVLGETWPYFRPNFA
NMKEIMVERGYSRIVGFVPTGWTYEVKHNKFSVRSKDSFEIHLVPYSEHSNYDELREYVK
FLRPKRVIPTVGVDIENLDSKHAVKMQKHFAGLVDEMANKKQFLMVFHRESSESDEKVEM
DDVPDLNKGLVQEKKDPSVVLNSSSTLQEPGSQNLTTINDEETEKMMQELSDCLPSWVTR
DQMLHLIGSSRGSLVDAVSNFHEHETEFHQQVFACGTAISSSQTGSIHESESHSKPILIK
RSQESLSTPSSQNYKSSKSNVKPSIKSGMSPGKKKRIAEIMPSKKVKTKSKLESGGRKQP
TITSFFSKLVPDVSQGSMVKLNPEKCPVDENPLPNDDTQSYTKEIDQFIRIIDGNEASRG
YAATILERTKGDINKALDMHYGNPEGNSGEGIERLVASGDLVEPQYHTNECSSSQDKTKL
VEEEHMVDLSMQRSLTQNLALAHVALPTEEYNPIQHACWRVGEPAPYIHLARTFDLVEAE
KGKIKATSIMCNMFRRFIFCTNVVLMMQELNIGGSLVTSAIEEACGTNRSKIRDMYNSLG
DLGDVAQVFRQTQTLLAPPPHLLVKDVFCVLRKISVQTGAGSTVRKKSLIVNLMRSCREK
EMKFIVRTLVRNLRIGAVMKTVLPALAQAVAMHSLVKSSEQKAESLKEKLQYLSAAVIEA
YNILPNLDLLIPSLISKGIDFSSSSLSMVPGVPIKPMLAKITNGVSQVLKLFQDKAFTCE
YKYDGQRAQIHKLPNGSIRVFSRNGDETTSRFPDLINIIEESCKPTAVTFIVDAEVVAVD
RKNGHKLMAFQELSSRERGSKDSSITLNKIKVQICVFVFDVMFANGEQLLELPLRQRRKY
LKDLFGDERKGYFEYAKETTVEACDASLTNDITETKINSFLENALRSSCEGIMVKTLDDH
AEYSPSKRTDTWLKVKRDYVEELNNSLDLVPIGAWHGNGRKAGWYSPFLMACYNPETEEF
QSVCRVMSGFSDAFYTEMKEYFSGDRILLKKPHYYRTAEVPDKWFSPEVVWEIRGAEFTV
SPVHQAAVGLVHPSRGISMRFPRFIRSVTDRNAEECSTAEDIADMFNSQTRKMDIIATN
NT seq 4140 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatcaacctctcagtcctcaaaaaggccaccattcaaaatcctaaattctctc
tccctttaccaaacctcactctcttcactttccctttccctcccaagtcaattccctcct
ctccctccctctctccctctctccaaacacatccctaaaacccgctttttaatcgatgca
tttcgcttctccactgccgccgccgcctacttcctcactcatttccactccgatcactac
tcaggtctctcctctaattggtcccaaggtatgatcttttgttcccagataaccgccaat
cttgtcactcgtatccttaatgttccctctcagtttgtttatccattgcctttgaatgat
actgtgattattgatggttctgaaattactttaattgatgctaatcactgccctggcgcg
gtacagctgttgtttaaagttaggagttctggtacttttgaaatgtatgttcatactggt
gattttagatattctagggaaatgaaagaagttgggattctacgcgactttgttggttgt
gacgccgtttttctggatactacttattgtaatcctaaatttgtttttcctaaacaacaa
gagtctattgattatgttgttagtgttattgagagaattggaggtgactttcaagcaatg
agtaagagagtgttgtttcttgttgcaacttatgtggttggaaaggagaggattttgatt
gagattgctaagaggtgtagaaggaaggttcatgttgataggaggaaaatggaggtcttg
agggttttgggatatggggaaagtggggtgtttactgaggatgagggtcagagtgatgtt
catgttgttggttggaatgtgttgggagagacttggccatatttccggccaaactttgct
aatatgaaggagattatggtggaaagagggtattcaaggattgtggggtttgtgcctact
gggtggacttatgaagtgaagcataataagttctcagtgagatcaaaggattcatttgag
atccatcttgtgccatatagtgagcattcaaattatgatgagctcagagagtatgtgaag
ttcctgagacctaagcgcgttattcctacagttggtgtggatattgaaaatcttgacagt
aaacatgctgtcaaaatgcagaaacattttgctggtttggttgatgaaatggctaacaag
aaacagtttttgatggtttttcatcgtgaatcctctgagagtgatgaaaaggttgaaatg
gatgatgtccctgacttgaataagggcctggtccaggagaaaaaggatccaagtgttgtt
ttgaactcctcatctaccctgcaagaacctggttcccaaaatttaaccacgataaatgat
gaggaaactgagaaaatgatgcaagaacttagtgactgtttgccttcttgggttacacga
gaccaaatgttacatttgattggtagctcaagaggaagtttggttgatgcagtttctaat
tttcatgagcatgaaacggaatttcatcaacaagtctttgcttgtgggacggccatctct
tcatctcagacaggttcaatccatgaatctgaatcacattcaaaaccaattttaattaag
aggagtcaagagagtttaagtactccttcaagtcaaaactataagtcatcaaaatcaaat
gtaaaaccttcaatcaagagcggcatgtcccctgggaaaaagaagaggattgctgaaatt
atgcctagcaagaaagtaaaaactaagtcgaaacttgaatctggtgggcggaagcagcct
accattacaagtttcttcagtaaacttgtgcctgatgtttctcagggtagtatggttaag
ttgaatcctgagaaatgtcctgtagatgaaaacccattgccaaatgatgatacacaatca
tacaccaaggagattgatcagtttattcggataattgatggcaacgaggcatcaagaggc
tatgctgccaccatccttgagaggacaaaaggagatataaataaggctctggatatgcat
tatggtaatccagagggtaattctggtgagggcatagagagattggtagcatcaggcgat
ttggttgagccccagtatcatactaatgagtgctcttcttcccaggataaaactaagtta
gtggaggaggaacatatggttgatctgtctatgcagagatcattgacacaaaatttggcc
ttagctcatgttgcactgccaacagaagagtacaatcctatacagcatgcatgctggagg
gttggagagcctgctccatatatccatcttgctaggacgtttgacctggttgaggctgaa
aagggaaagattaaagctacttctataatgtgcaatatgtttagaaggtttatattttgt
actaatgtggtcctaatgatgcaggagctaaatatcggtggaagcttggtcacatcagca
atagaagaggcatgtgggacaaatcggtctaaaataagggacatgtacaatagtttggga
gatcttggtgatgttgctcaagtattccggcaaacgcagacgttgcttgcccctcctcct
caccttcttgttaaagatgtattttgtgtgctccggaagataagtgtgcagacaggcgct
ggaagcaccgttcgaaagaagagcctcattgtaaatcttatgcgatcgtgtagggaaaag
gagatgaagtttattgttagaacattggtgaggaatctacgaattggagcagtgatgaaa
acggttctacctgcactggcccaagcagttgctatgcattccttggtcaaatcttctgaa
cagaaagctgaaagtttgaaggagaaacttcagtacctttctgcagcagttattgaagct
tataacatacttccaaatttggatttgctcattccttcactcataagtaaaggcattgat
ttttcgtcgtcaagtttgtcaatggtgccaggagtacctattaaacccatgcttgcaaaa
attacaaatggagtttctcaagtgctgaaactcttccaggataaagcttttacatgtgaa
tacaaatatgatggtcaaagggcccaaattcacaaattaccaaatggcagtattcgtgtc
ttttcaaggaatggggatgaaacaacatcaagatttcctgatttgatcaatataattgag
gaatcttgtaaacctactgcagtgacttttatagtggatgctgaggtagttgcagttgat
agaaaaaatggtcacaagctcatggccttccaagaactatcttcaagggaaagagggagc
aaagattcatctatcacactgaataaaataaaggtccagatctgcgtgtttgtctttgat
gtcatgtttgctaatggagaacagctgttggagcttcctctccggcagagaaggaaatac
ctgaaggatttgtttggtgatgagaggaagggttattttgaatatgcaaaggaaacaacg
gttgaagcatgtgatgcttctttaaccaatgacataacagagaccaagataaactctttc
cttgaaaatgcattgcgctcttcatgtgaaggaattatggtgaaaactttagatgatcat
gcagaatattcaccatcaaaacgtactgacacatggctaaaggtcaagcgagattatgtg
gaagaattgaataattctcttgatttagttcctattggtgcttggcatggaaatgggaga
aaagcaggatggtatagtccattcctcatggcatgttacaaccctgagactgaggaattc
caaagtgtgtgccgtgtcatgtctgggttctcagatgcattttacactgagatgaaagaa
tatttttctggagatcgaatcttgttaaaaaagccacactactatcgaactgctgaagtc
ccggacaagtggttttctccagaagtcgtttgggaaatacgcggtgcagaatttacagtc
tcaccagttcatcaggctgctgtaggtttagttcatccatcccgtggcatctcaatgaga
tttccaagatttatccgctctgtgacagatagaaatgcagaagaatgtagtacagctgaa
gacattgcagacatgttcaattctcaaacacggaagatggatataatagctacaaattaa

DBGET integrated database retrieval system