KEGG   Ricinus communis (castor bean): 8269690Help
Entry
8269690           CDS       T01087                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00010  Glycolysis / Gluconeogenesis
rcu00020  Citrate cycle (TCA cycle)
rcu00620  Pyruvate metabolism
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
rcu01200  Carbon metabolism
Module
rcu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8269690
   00020 Citrate cycle (TCA cycle)
    8269690
   00620 Pyruvate metabolism
    8269690
Enzymes [BR:rcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     8269690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 8269690
NCBI-ProteinID: XP_002529121
UniProt: B9ST02
LinkDB All DBs
Position
Unknown
AA seq 483 aa AA seqDB search
MAASSPFLSKIPISNKTISFSSSLSPSFPPTFPSKSHHRQNHARRSNALRVQSKIREIFM
PALSSTMTEGKIVSWIKAEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGESA
PVGAPIGLLAETEDEIAEAKAKANANTNASSSQTTAAVAPTPPPVSSTRAPAIAQPAPAA
SAPEGPKKIVATPYARKLAKQHTVDINKLVGSGPNGRITPADVEAAAGIKSVASAPVAAA
APAAAPAKAPPAAAAPPPLPGSTVVPFTTMQSAVSKNMVESLSVPTFRVGYPISTDALDA
LYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNSNINIAVAVAINGGLIT
PVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPG
QGAIMAVGASKPTVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIVENPES
LTL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcatctccctttctctccaaaatcccaatctcgaacaaaacaatttccttc
tcttcctcactttccccatctttcccacccacatttccctccaaatcacaccatcgccaa
aaccacgccagacgcagcaatgcgttgagagtccagtccaagatccgagagatcttcatg
ccagcactcagctccacaatgaccgagggcaaaatcgtctcttggattaaggcagaaggc
gacgttctttccaaaggagaaagcgtcgtcgttgttgaatctgataaagctgacatggat
gttgagactttttacgatggcattctcgctgctattgttgtccctgaaggtgaatctgct
cctgttggtgctcctattggtcttttagctgagactgaagatgagattgccgaagctaaa
gccaaagcgaatgccaataccaatgcctcctcctcacaaactactgctgctgttgctcct
actcctcctcccgttagttctactcgtgcgccagctattgcacaacctgctcctgcagcc
agtgccccagagggacctaagaagattgtggcaacaccttatgctaggaagctagcgaag
cagcatacagtggatattaataaattggttggttccgggcctaatggaaggatcacacct
gctgacgtagaagctgctgctgggattaagtctgtggcttctgcgcctgttgcggcggcg
gctcctgctgctgctccagctaaagctcctcctgctgctgctgctcctcctccgcttcca
ggatctacggttgtgccatttacaacaatgcaatcagctgtttcgaagaacatggtggag
agcctctctgtacctacttttagagttgggtacccaatatcaactgatgccctcgatgct
ctatatgagaaggtgaaaccaaagggtgtaacaatgactgcattattagcaaaagctgca
gcaatggcacttgctcagcacccagttgtcaatgcaagttgtaaagatgggaaaagtttt
acttataacagtaacattaacattgcagtggctgtggctatcaatggtgggttgattact
cctgttcttcaagatgcagataagttggacctttacctgttatcacaaaagtggaaagag
ttggtggagaaagccagatcaaaacaactacagcctcatgagtacaattcagggacattc
actctttccaatttgggaatgtttggagtggacaggtttgatgctattcttcctcctggc
cagggggctataatggctgttggagcatcaaaaccaactgtggtggctgataaagatgga
ttctttagtgtaaaaagcaaaatgctggtgaatgtaacagctgatcaccgaattgtctat
ggggctgacttggctgccttccttcagacctttgctaaaatagttgagaacccagaaagc
ctgacactgtag

DBGET integrated database retrieval system