KEGG   Ricinus communis (castor bean): 8275247Help
Entry
8275247           CDS       T01087                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8275247
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     8275247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 8275247
NCBI-ProteinID: XP_002523728
UniProt: B9SCK9
LinkDB All DBs
Position
Unknown
AA seq 213 aa AA seqDB search
MAAHTIIAASPSYHALLSPASSPNLTHSLFHGNSVLKLSRQSVALSLSSAAKKSLTVVAA
TKKAVAVLKGNSNVEGVVTLTQGDDGPTTVNVRITGLTPGLHGFHLHEYGDTTNGCMSTG
AHFNPKGLTHGSPEDDIRHAGDLGNIVANADGVAEATIVDSQIPLSGPNAVIGRALVVHE
LEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcatactatcattgcagcatctccatcatatcacgctcttctttctccagct
tcaagtcctaatctcacccattcgttattccatggtaactcagtcctcaaactctctcgt
caatccgttgctctatctctctcatccgccgctaagaaatcacttaccgttgtggctgcg
actaagaaagctgtcgctgttcttaaaggcaattctaatgttgaaggcgttgttactttg
actcaaggagatgatggccccacaactgtgaatgttcgaatcaccggtcttactccagga
cttcatgggttccacctacatgagtatggtgacacaacaaatggatgcatgtcaacaggg
gcacatttcaatcctaagggcttgacacatggtagtcctgaagatgatatccgccatgcg
ggcgacctgggaaacatagtagctaatgctgatggtgtagcagaagctacaattgtggat
agccagataccgttgagtggtcctaatgcagtaattggaagagcgcttgttgtccacgag
cttgaggatgaccttggaaaaggtggacatgaacttagtttgaccactggcaacgcaggt
ggaagattggcatgtggtgttgttggtttgacgccagtgtaa

DBGET integrated database retrieval system