KEGG   Ricinus communis (castor bean): 8276551Help
Entry
8276551           CDS       T01087                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00220  Arginine biosynthesis
rcu00250  Alanine, aspartate and glutamate metabolism
rcu00710  Carbon fixation in photosynthetic organisms
rcu01100  Metabolic pathways
rcu01200  Carbon metabolism
rcu01210  2-Oxocarboxylic acid metabolism
rcu01230  Biosynthesis of amino acids
Module
rcu_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    8276551
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    8276551
   00220 Arginine biosynthesis
    8276551
Enzymes [BR:rcu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     8276551
Amino acid related enzymes [BR:rcu01007]
 Aminotransferase (transaminase)
  Class I
   8276551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 8276551
NCBI-ProteinID: XP_015583166
LinkDB All DBs
Position
Un
AA seq 534 aa AA seqDB search
MRRFVIGRAKNLLNRSSQYQPKRQHQSFDLPVPSHSRFLSSTSVLDFPSSSSPMAPLSLN
TINPKVLECEYAVRGEIVTIAQRLQEELKTNPGSHPFDEILYCNIGNPQSLGQQPITFFR
EVLALCDHPAILDKSETQGLFSADAIDRAWQILDQIPGRATGAYSHSQGIKGLRDTIAAG
IETRDGFPADPNDIFLTDGASPSVHMMMQLLIRSEKDGILCPIPQYPLYSASIALHGGSL
VPYYLDEATGWGLEISELKKQLEDAKSKGITVRALVVINPGNPTGQVLAEDNQRAIVEFC
KQEGLVLLADEVYQENVYVPEKQFHSFKKISRSMGYGEEDISLVSFQSVSKGYYGECGKR
GGYMEVTGFAPEIREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYDSYSAEKDGIL
SSLARRAKTLEDAFSNLEGITCNKAEGAMYLFPCIRLPEKAIKAAEAAKKAPDAFYCQRL
LNTTGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLSEFHKSFMDEFRD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtgattggcagagctaagaacctcctcaaccgctcctctcaatatcaa
cctaaacgtcaacatcaaagctttgatcttcctgtgccttctcattcacgtttcttatct
tcgacttctgttcttgatttcccttcttcttcttcacctatggctcctctctctcttaat
actattaatccgaaggttttggaatgtgaatatgctgtccgtggtgagattgtcaccatt
gcacagcggttacaagaagagttaaagactaacccgggttctcatccttttgatgagatt
ctttactgcaatattgggaatcctcagtctcttggtcagcagccgataacattttttcga
gaggttcttgcattatgcgatcatcctgctattttggacaaaagtgaaacacagggtttg
ttcagtgctgatgccattgaccgagcttggcagattcttgatcaaattcctggaagagca
actggtgcttacagtcacagtcagggtatcaagggattacgtgatacaattgctgctgga
attgaaactcgtgatggttttcctgctgatccaaatgatattttcttgacagatggcgca
agtccatcggttcatatgatgatgcagttactgattagatcagaaaaggatggaatactc
tgtcccattcctcagtaccctttgtattctgcctcaattgctctccatggtggcagtctg
gttccatactatcttgatgaagcaactgggtggggattggaaatctctgagcttaagaag
caattggaggatgccaagtctaaaggtattactgtcagggcattagtcgtaataaatcct
ggcaacccaacagggcaggttcttgctgaggacaaccagcgagcaattgtagagttctgc
aagcaagaaggtcttgttcttctggcagatgaggtttatcaagaaaacgtatatgttcca
gagaagcagtttcactcatttaagaagatttcccggtctatgggctatggtgaagaggat
atatctctagtatctttccagtctgtgtctaaagggtactatggagaatgtggaaagaga
ggaggttatatggaggtcactgggtttgctcctgaaataagggagcaaatatacaaagtg
gcatctgtgaatctttgttccaatatttctggccaaattctagccagtcttgtcatgagt
ccgcccaaggttggagatgaatcctatgattcatattctgcagagaaagatggaatcctg
tcatcccttgcaagacgtgcaaagacattggaagatgcattcagcaatttggagggtatc
acatgtaacaaggcagaaggagcaatgtatctctttccctgcattcgtctgcctgaaaag
gcaattaaagctgcagaagctgcgaaaaaagctccagatgcgttctattgtcagcgtctt
ctcaatacaactggagtagttgttgttcctggttctggctttggacaggttcctggcaca
tggcattttaggtgcaccatactgcctcaggaggataagattccggcaattgtatctcgc
ctgtcggagttccacaagagtttcatggatgagtttcgtgactga

DBGET integrated database retrieval system