KEGG   Ricinus communis (castor bean): 8283123Help
Entry
8283123           CDS       T01087                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00020  Citrate cycle (TCA cycle)
rcu00190  Oxidative phosphorylation
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
rcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    8283123
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    8283123
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     8283123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 8283123
NCBI-ProteinID: XP_015581664
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MWRCVARGLRVPSSSSKKSIYYDSVRSHISMIMYIWQSAGQSSYTIVDHTYDAVVVGAGG
AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCAC
AADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIAMNMEDGTLHRFRAA
STILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEG
SRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNH
LPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTVKGNDPD
SVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAG
ERTIAWLDKLRNSNGSLPTSKIRLNMQRTMQNNAAVFRTQETLEEGCQLIDKAWESFHDV
KLKDRSLIWNSDLIETVELENLLINACITMHSAEARKESRGAHAREDFTKRDDKDWMKHT
LGYWENEKVRLDYRPVHMNTLDDEMETIPPKARVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtagctcgtgggcttcgtgttccttcttcttcttcaaagaaatcgatc
tattatgactctgttagatctcacatctctatgatcatgtatatatggcagagcgccggg
caatcgtcatatacaatcgttgatcatacatatgatgcagtagtcgtaggagctggtggt
gcagggttgagggctgccatagggctctcagagcatgggtttaacactgcgtgtattacc
aagcttttcccaacacgttcacacactgttgccgctcagggtggcatcaatgctgcttta
ggaaacatgacagaagatgactggagatggcacatgtatgacactgtcaagggaagtgat
tggttaggtgatcaggatgccattcaatacatgtgtagagaggcaccaaaggcagtcatt
gaacttgagaactatgggttaccattttctcgaacagaagatgggcgaatttatcagcgt
gcatttggtggtcagagtctagattttggaaaaggtggacaggcatatcgttgtgcatgt
gctgctgaccgaactgggcatgctcttctgcatactctctatggtcaagctatgaaacat
aatacacaattttttgtggaatattttgctttggatcttttaatgaatagtgatggtagc
tgccaaggagtaattgctatgaatatggaagatggtactttacatcgattccgtgctgct
tccaccatcctggccacagggggctatggtagggcatacttttctgcaacctcagctcat
acatgcactggagatggcaatgctatggttgcacgggctgggcttcccctccaggatctg
gaatttgttcagtttcatcctacaggcatatatggagctggttgtctaattactgaaggt
tctcgtggtgaaggtggtattcttaggaatagtgaaggtgagcgattcatggaaaggtat
gctcctacagcaaaagatcttgcatcaagggatgttgtttcaagatctatgaccatggag
attcgggagggtcgtggtgtaggacctttgaaggatcatatctatctgcacttaaatcac
ttgcccccagatgtactgaaagagaggcttcctggtatttctgaaactgcagccattttt
gctggtgttgatgttacgaaggaacctatccctgtgttacctactgtgcattacaatatg
ggtggaatccccacaaattaccatggagaggtggtaacagttaaaggaaacgatcctgat
tctgtagttcctggactaatggctgcaggggaggccgcctgtgcatcagttcatggtgcc
aatcggcttggtgcaaattctctgcttgacattgtggtttttggtcgtgcttgtgcaaat
agagtggcggagattcaaagaccaggtgagaaacaaaagcctctggaaaaggatgctgga
gagaggaccattgcatggctggacaaactaagaaattctaatggttcacttccgacttca
aaaattcggttaaatatgcagaggacaatgcaaaataatgctgctgttttccgtacacaa
gaaacattggaagaaggttgtcagttgattgacaaggcatgggagagcttccatgatgtt
aagttgaaagatcgaagtttaatatggaactctgatttgatagagactgtagaactggaa
aaccttttgataaatgcctgtattacgatgcattctgctgaggcccgaaaagagagcaga
ggagcacatgcccgtgaagactttactaaaagagatgataaagactggatgaagcacact
ttgggatactgggagaatgagaaggtccgacttgattacaggccagtacacatgaacaca
ttagatgatgagatggagacgatcccgcctaaagctcgtgtttactga

DBGET integrated database retrieval system