KEGG   Ricinus communis (castor bean): 8288580Help
Entry
8288580           CDS       T01087                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00052  Galactose metabolism
rcu00511  Other glycan degradation
rcu00531  Glycosaminoglycan degradation
rcu00600  Sphingolipid metabolism
rcu00604  Glycosphingolipid biosynthesis - ganglio series
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    8288580
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    8288580
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    8288580
   00604 Glycosphingolipid biosynthesis - ganglio series
    8288580
   00511 Other glycan degradation
    8288580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcu04147]
    8288580
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     8288580
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8288580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5 Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 8288580
NCBI-ProteinID: XP_025014596
LinkDB All DBs
Position
Unknown
AA seq 658 aa AA seqDB search
MIRAKRNDTNPVTMVTKKRSHPKTTLFLAVIICLLALAVLVPVVFAPLPSLSHSHSHRHR
KVNARRSFEINDDMFWRDGKPFRIIGGDLHYFRILPQYWEDRLLRAKALGLNTVQTYVPW
NLHEPQPGRLVFEGIADLVSFLQLCQKLDLLVMLRPGPYICADSNGGPIIMVQIENEFGS
YGDDKAYLHHLIKLAREHLGERIILYTTDGGSRETLEKGTIRGDTVFSAVDFATGDDPWP
IFNLQKKFNAPGKSPPLSAEFYTGWLTHWGEKIAQTDAEFTASSLEKILSRNGSAVLYMA
HGGTNFGFYNGANTGADESDYKPDLTSYDYDAPISESGDVDNAKFNALRRVIGVHSAASL
PSVPPNNDKTGYGPIQLHKTTFLFDLLDTINPADVVESKNPVSMESAGQMFGFLVYVTRY
APKVDGSTLYIPEVHDRGQVFTLCPSDGSSGRPVYAGAIERWSNQKVLLPNSKCASNISL
FVLVENMGRVNYGRYMFDRKGILSSVYLDGRILNGWRMISLPLHNLNEVPKINPIIQAVH
STLSTRTKLEDYPRSFSIEPAFYTGYFFIEKEDQVKDTFISFSGWGKGIAFVNDFNLGRY
WPSFGPQCNLYVPSPVLRHGKNVLVILELESPHSELVIHSVSQPDFKCGSSRLNVHQL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagccaaaagaaacgacactaatccagtaacaatggtgacgaaaaagagatca
catcctaaaacgacgctgttcttagcagtcataatttgcttgctagctttagcagtgttg
gttccagtggtcttcgctcctctcccttctctatctcactctcactctcatcgtcacaga
aaggtaaatgccagaagaagctttgagattaatgatgatatgttttggagagatggtaag
ccatttaggataatcggtggtgacttgcactattttcgaattcttcctcagtactgggaa
gataggttattgagagcaaaggctctgggcttgaatacagttcaaacttatgttccttgg
aatctacatgaaccgcaacctggcaggttggtttttgaaggtattgccgacctagtttca
tttctccaactctgtcagaagctggatttgcttgttatgcttcgacctggcccttatata
tgtgcagatagcaatgggggtcctattataatggttcagattgaaaatgaatttgggtca
tatggagatgacaaagcttatcttcatcacctgatcaaattggccagggaacatcttggg
gagaggataattttatataccacagatggaggttctagggaaactcttgagaaaggaaca
attcgtggagatactgtcttttcagctgttgatttcgctaccggtgatgatccttggcct
atattcaatttacaaaagaagttcaatgccccagggaaatcaccaccactttccgcggag
ttctatactggttggctgacacactggggagagaagattgcacagacagatgctgaattt
acagcatcttccttggaaaagattttatcacgaaatggttctgctgtgctttatatggca
catggtggaacaaactttggattttacaatggggcaaatactggtgcagacgagtctgat
tacaagccagatctcacttcctatgattatgatgcaccaattagcgaatctggtgatgtg
gataatgcaaaatttaatgcactgcggagggttataggggttcatagtgcagcatctctt
ccctcagttccgcccaataatgacaagacaggatatggacctattcaactacataaaaca
acatttttgtttgatttacttgatacgataaatcctgctgatgtggttgaatccaaaaac
ccagtctcaatggaatctgcgggacagatgtttggatttctagtatatgttactcgatat
gctccaaaggttgatgggagtactctatatataccagaggtgcatgatagaggtcaggtg
tttacattgtgcccttctgatggtagcagtggaaggccagtgtatgctggtgcaattgaa
aggtggtcgaatcaaaaagttctccttcctaattccaaatgtgcttccaacatcagctta
tttgttttggtcgagaacatgggccgtgtaaattatgggcggtacatgtttgataggaag
ggaattttgtcatctgtttatctggacggtagaattttgaatgggtggagaatgatttca
cttcctcttcacaatctgaacgaggtgccaaaaatcaatcccatcattcaagctgtacat
tcaacattatcaactcgcacaaaattagaagattacccaaggagtttttccatagaacca
gcattctatacagggtatttttttattgagaaagaagaccaagttaaagatacattcata
tcattcagcggttggggtaaagggatagcttttgtaaatgattttaacttaggaagatat
tggccgtcgtttggaccacaatgcaacctttatgtcccttctccagtcctcaggcatggg
aaaaatgttctggttattctggagttagaatctcctcattcagagcttgtgatacattca
gtgagccagccagacttcaagtgtggttcaagtagattgaatgtgcatcagctctag

DBGET integrated database retrieval system