KEGG   Ricinus communis (castor bean): 8289031Help
Entry
8289031           CDS       T01087                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00010  Glycolysis / Gluconeogenesis
rcu00053  Ascorbate and aldarate metabolism
rcu00071  Fatty acid degradation
rcu00280  Valine, leucine and isoleucine degradation
rcu00310  Lysine degradation
rcu00330  Arginine and proline metabolism
rcu00340  Histidine metabolism
rcu00380  Tryptophan metabolism
rcu00410  beta-Alanine metabolism
rcu00561  Glycerolipid metabolism
rcu00620  Pyruvate metabolism
rcu00903  Limonene and pinene degradation
rcu01100  Metabolic pathways
rcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8289031
   00053 Ascorbate and aldarate metabolism
    8289031
   00620 Pyruvate metabolism
    8289031
  09103 Lipid metabolism
   00071 Fatty acid degradation
    8289031
   00561 Glycerolipid metabolism
    8289031
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    8289031
   00310 Lysine degradation
    8289031
   00330 Arginine and proline metabolism
    8289031
   00340 Histidine metabolism
    8289031
   00380 Tryptophan metabolism
    8289031
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    8289031
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    8289031
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     8289031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 8289031
NCBI-ProteinID: XP_025014635
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MAAPRISSLISRSLSASLLLSLGKNPNRGRSIYRFSTAAVAEEPITPPVQISYTQHFING
QFVDAASGKTFPAYDPRTGQVIAQVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERSRI
ILRFAELVEKNNDELAALETWNNGKPYEQSAKSELPLLSRLFHYYAGWADKIHGLTVPAD
GNHHVQILHEPIGVAGQIIPWNFPLILFAWKVGPALACGNTIVLKTAEQTPLTALYAAKL
FHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTETGKIVLELSAKSNLKPVTL
ELGGKSPFVVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFLEKAKARAM
RRVVGDPFRKGVEQGPQIDSEQFQKVLRYIKSGIESNATLECGGDRFGPRGYFIQPTVFS
NVQDDMLIAQDEIFGPVQSILKFKDLDEVIRRANTTRYGLAAGVFTNNIDTANTLSRALR
AGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccaaggatatcttctttaatctcccgctctctttctgcttctctgctcctt
tctctaggaaaaaatcctaacaggggaagaagcatctacaggtttagtactgctgcagta
gctgaggaaccaatcaccccacctgttcaaataagctatactcagcattttatcaatggt
caattcgttgatgcagcatctgggaaaacatttccagcgtatgatcctcgtacaggacaa
gtaattgctcaagtagctgaaggtgatgctgaagatataaaccgagcagtagctgctgct
agaaaagcatttgatgaaggaccatggccaaagatgactgcttatgaaaggtcacggata
atcttgcgttttgctgaattggttgaaaaaaacaatgatgagcttgcggctttagagaca
tggaataatgggaagccttatgaacagtctgctaaatctgaattaccactgctgtcccgt
ctatttcactattatgctggatgggctgacaagattcacgggctaacagttccagcagat
ggtaatcaccatgttcaaatattgcacgaacctattggagttgcagggcagataattcca
tggaactttcctcttatcttgtttgcttggaaagttggtcctgcattagcttgcggtaat
actattgttcttaagacagcagaacagactcctcttactgctctttatgcagcaaagcta
tttcatgaggctggtcttcctccaggtgttttgaatgtagtttcaggctatggtccgact
gctggggcagcccttgccagccacatggatgtagacaagcttgcttttacaggatcaact
gaaactggtaaaattgtgctagaactgtctgcaaaaagtaaccttaagccagttacatta
gagcttggtggaaaatcgcctttcgtagtttgcgaggatgctgacgtcgataaggctgtg
gagcttgcacactttgctttgttctttaatcagggtcaatgctgctgcgctgggtctcgg
acatatgtacacgagcgtgtgtatgatgagtttctagagaaagcgaaggcccgtgccatg
agacgtgtagttggtgatcctttcagaaagggtgttgaacaaggtcctcagattgactcg
gagcaatttcagaaagttcttaggtatataaaatccggtattgaaagcaatgctaccctt
gaatgtggaggcgacaggtttggccccaggggctactttatccaacccactgttttctca
aatgttcaggatgacatgctgatagcacaggatgagatctttggcccagtgcaatcaatc
ttgaagttcaaggaccttgatgaagtaataagaagggcaaatactacacgttatggttta
gctgcaggagttttcaccaataacattgacactgccaacacattgtcaagagcactgcga
gcaggaacagtgtgggttaactgctttgatgtgtttgatgcagcgataccttttggtggt
tataagatgagtggtataggcagggagaagggtatctacagccttaacaactacttgcaa
gttaaagcagttgttactccattaaagaatccggcatggctgtaa

DBGET integrated database retrieval system