KEGG   Roseobacter denitrificans: RD1_0136Help
Entry
RD1_0136          CDS       T00376                                 

Gene name
bchL
Definition
(GenBank) light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rde  Roseobacter denitrificans
Pathway
rde00860  Porphyrin and chlorophyll metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD1_0136 (bchL)
Enzymes [BR:rde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RD1_0136 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB MipZ AAA_26 NB-ARC CBP_BcsQ AAA_25
Motif
Other DBs
NCBI-ProteinID: ABG29871
RoseoBase: RD1_0136
UniProt: Q16DS2
LinkDB All DBs
Position
complement(134016..134915)
Genome map
AA seq 299 aa AA seqDB search
MSPLDRTPPSLRGQDGEGSVQVHQDETAKIEGAKVFSVYGKGGIGKSTTSSNLSAAFSML
GKRVLQIGCDPKHDSTFTLTGSLVPTVIDILKEVDFHPEELRAEDFVFDGFNGVKCVEAG
GPPAGTGCGGYVVGQTVKLLKQHHMLEDTDVVIFDVLGDVVCGGFAAPLQHADRALIVTA
NDFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRSRETDEVDRYCDTVGFNRIAHMPDLD
AIRRSRLKKKTLFEMPDDEEIVQVRKEYIRLAETLWNGTEPLAPAPLPDRDIFELLGFD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcccattggacagaacaccgcccagcctgcgtggtcaggacggcgaaggatccgta
caggtccatcaggacgaaaccgccaagatcgaaggggccaaggtcttttccgtctatggc
aagggtggtatcggcaaatccaccacatcctcgaacctgtcagcggcattttccatgctg
ggcaaacgggtgttgcagatcggctgtgaccccaaacacgacagcactttcacgctgacc
ggcagtttggtgcccactgtgatcgacattctgaaagaggtggatttccatcccgaggaa
ctgcgcgccgaagatttcgtctttgacgggttcaacggtgtgaaatgcgtcgaagcgggc
ggcccgcctgcgggtaccggttgcggcggctatgtcgtcgggcagaccgtcaaattgctg
aagcagcaccatatgctggaagacacggacgtcgtgatctttgacgtgctcggcgatgtg
gtctgcggtggttttgccgcgccccttcagcacgccgaccgcgcgctgatcgtcacggcc
aatgatttcgacagcatctatgcgatgaaccggatcattgcggcggtgcaggccaaatca
aagaactacaaagtgcgccttgcaggctgcgttgcgaaccggtcgcgcgaaaccgatgag
gtggaccgctattgcgacaccgtcgggttcaaccgcattgcccatatgcctgaccttgat
gcgatccggcgctcccggctcaagaaaaagacgctctttgagatgcctgacgatgaagag
atcgtacaggtgcgcaaggaatacatccgtctggccgaaacgctgtggaacggaaccgag
ccgctggccccggcacctttacccgaccgggatatctttgaacttctgggatttgattga

DBGET integrated database retrieval system