KEGG   Roseobacter denitrificans: RD1_1396Help
Entry
RD1_1396          CDS       T00376                                 

Gene name
tufA
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rde  Roseobacter denitrificans
Brite
KEGG Orthology (KO) [BR:rde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rde03012]
    RD1_1396 (tufA)
   03029 Mitochondrial biogenesis [BR:rde03029]
    RD1_1396 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rde04147]
    RD1_1396 (tufA)
Translation factors [BR:rde03012]
 Eukaryotic Type
  Elongation factors
   RD1_1396 (tufA)
 Prokaryotic Type
   RD1_1396 (tufA)
Mitochondrial biogenesis [BR:rde03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RD1_1396 (tufA)
Exosome [BR:rde04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RD1_1396 (tufA)
  Exosomal proteins of breast cancer cells
   RD1_1396 (tufA)
  Exosomal proteins of colorectal cancer cells
   RD1_1396 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ABG31036
RoseoBase: RD1_1396
UniProt: Q160Y4
LinkDB All DBs
Position
1339709..1340884
Genome map
AA seq 391 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGDFQAYDQIDGAPEEKARGITIST
AHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHILLGRQ
VGIPTMVVFMNKVDQVDDEELLELVEMEIRELLSSYDYPGDDIPVIPGSALAAMEGRDPE
IGEEAIKKLMAAVDEFIPTPERAIDQPFLMPVEDVFSISGRGTVVTGRVERGVINVGDNI
EIVGIKDTQSTTCTGVEMFRKLLDRGEAGDNIGALLRGIDREAVERGQVLCKPGSVKPHT
KFEAEAYILTKDEGGRHTPFFANYRPQFYFRTTDVTGTVQLAEGTEMVMPGDNVSFGVEL
IAPIAMEQGLRFAIREGGRTVGAGVVSKITE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcaaagtttgaacgtaataaaccgcatgttaacattggcacgattggtcac
gttgaccacggcaagacgacgctgacggctgcgattacgaagtatttcggtgattttcag
gcgtatgaccagattgacggcgcgcctgaggagaaagcgcgcgggatcacgatttcgacc
gcgcatgtggaatacgagacggaaaaccgtcactacgcgcatgtggattgccccggtcac
gcggactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtgaacgcggctgacggcccgatgccccagacgcgcgagcacatcctgctgggtcgccag
gttggcatcccgacgatggttgtcttcatgaacaaggtcgatcaggtcgatgacgaggaa
ctgcttgagctggtcgagatggaaatccgcgagctgctgtcctcctacgactaccccggc
gacgacattcccgtgatccccggctccgcgctggcggcgatggaagggcgtgatcccgag
atcggtgaagaggcgatcaagaagctgatggcggctgtggatgagttcatcccgacgcct
gagcgtgcgattgaccagccgttcctgatgccggttgaggacgtcttctcgatctccggt
cgtggtactgttgtgacgggccgtgttgagcgtggcgtgatcaacgtgggcgacaacatc
gagatcgtggggatcaaggacacccagagcacaacatgtacgggtgttgagatgttccgc
aagctgctggatcgcggtgaggcgggcgacaacatcggcgcgctgctgcgtggtattgac
cgtgaggcggttgagcgtggccaggttctgtgcaagccggggtcggtcaagccacacacg
aagttcgaggccgaagcctatatcctgaccaaggacgaaggtggccgccacacgccgttc
tttgcgaactaccgcccgcagttctacttccgcacaacggacgtgacgggcacggttcag
ctggcggaaggcaccgagatggtcatgccgggcgacaacgtgtcctttggcgttgaactg
atcgcaccgatcgcgatggagcagggcctgcgctttgcgatccgcgaaggcggccgcacc
gtcggcgccggcgtcgtgtcgaagattacggagtaa

DBGET integrated database retrieval system