KEGG   Roseobacter denitrificans: RD1_2595Help
Entry
RD1_2595          CDS       T00376                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rde  Roseobacter denitrificans
Pathway
rde00061  Fatty acid biosynthesis
rde00780  Biotin metabolism
rde01100  Metabolic pathways
rde01212  Fatty acid metabolism
Module
rde_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RD1_2595 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RD1_2595 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rde01004]
    RD1_2595 (fabZ)
Enzymes [BR:rde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RD1_2595 (fabZ)
Lipid biosynthesis proteins [BR:rde01004]
 Fatty acid synthase
  Component type
   RD1_2595 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ABG32146
RoseoBase: RD1_2595
UniProt: Q166E7
LinkDB All DBs
Position
2478861..2479319
Genome map
AA seq 152 aa AA seqDB search
MSTSQTSADIQLIQRILPHRYPFLLVDKVVEIDGTTSALGIKNVTMNEPHFQGHFPGMPI
MPGVTIVEAMAQTAAVMVGVTLEMADKEMKVYFMAIDKAKFRRKVIPGDVLEMRLNTLRG
KPGGKVWRFGGVASVEGEMAAEVEFTAMMDMG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccagccagaccagcgcggatattcaactgatccagcgtatcctacctcatcgc
tatccctttctgcttgtcgacaaggtggtggaaatcgacggcaccacatccgccctcggc
atcaagaatgtcaccatgaatgagccgcattttcagggccatttcccgggaatgcccatc
atgccgggcgttacgatcgtggaagccatggcacaaacggctgcggtcatggtcggtgtg
acgctggaaatggcggataaggaaatgaaagtgtatttcatggcaatcgacaaggcgaag
ttccgtcgcaaggtcatccccggtgatgtgcttgagatgcggctgaacaccctgcgtggc
aaacccggcggcaaagtctggcgctttggcggtgtcgcatcggttgagggcgagatggcc
gccgaagtcgagtttaccgccatgatggacatgggctga

DBGET integrated database retrieval system