KEGG   Roseobacter denitrificans: RD1_2884Help
Entry
RD1_2884          CDS       T00376                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rde  Roseobacter denitrificans
Pathway
rde00564  Glycerophospholipid metabolism
rde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RD1_2884 (glpD)
Enzymes [BR:rde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RD1_2884 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: ABG32409
RoseoBase: RD1_2884
UniProt: Q165D4
LinkDB All DBs
Position
complement(2761375..2762973)
Genome map
AA seq 532 aa AA seqDB search
MPNDQEKPYDLFIIGGGINGCGIARDAAGRGLHVALAEMNDLASATSSASTKLFHGGLRY
LEYFEINLVKHALAEREVLLKAMPHISWPMRFVLPYHRDMRFEGSTPTSRILNTVMPWMK
GRRPAWLIRFGLFLYDNLGGRDILPGTKTLDLRGGPEGAPLVKKFEKAFEYSDCWVEDSR
LVVLNARDAAARGASVMVRTKVVSAARVDDLWEVSLQDVTTGQMRKLRARMLVNAGGPWV
GDIIQQKVRINSTEGVRLVRGSHIVTRKLYDHDKCYFFQGMDGRIIFAIPYETDFTLIGT
TDAEHPDPSVSPECTPQERDYLIDFANQYFDHDISRDDVVWTYSGVRPLYDDGASSATAA
TRDYTLKVDEAGGAPILNVFGGKITTYRKLAEDAMERIVPFFPGTSGHWTAGVPLPGGDF
AVGDFDTLVARLRDDFPFLSHFCARRLVRAYGTESWDIMAGAQKVEELGEHFGHGLRARE
VLWLMTHEYAQTAEDILWRRNKLGLRMSPQEVSVLDDFMQAHRLKEGSDAAQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaatgatcaagagaagccctacgatctgttcatcatcggtggtggcataaacggc
tgcggtatcgcgcgcgatgcggccgggcggggcctgcatgttgcgctggcagaaatgaac
gatctggcctcggccacatcttctgcatcgaccaagctgtttcatggcggtctgcgctat
cttgagtatttcgagatcaatctggtcaaacatgctctggcagagcgtgaagtgctgttg
aaagccatgccgcatatcagttggcccatgcgctttgtgttgccctatcaccgcgacatg
aggttcgagggcagcacgccaacctcgcgcatcctcaataccgtaatgccctggatgaag
gggcggcggcctgcatggctgatccggtttggtcttttcctgtatgacaatctgggtggt
cgcgacatcctgccggggacaaaaacgctggatttgcgcggggggcctgagggcgcacca
ctggtgaaaaagttcgaaaaggcttttgaatattcagattgctgggttgaggattcgcgc
cttgtcgttctgaacgcgcgtgatgctgccgcgcggggagcatccgtgatggtgcgcacc
aaagtcgtgtctgccgcgcgcgtcgacgatctgtgggaggtgagcctgcaggacgtgacc
acagggcagatgcgcaagctgcgggcgcgcatgctggtcaatgcaggcgggccgtgggtc
ggggatatcatccagcaaaaggtgcggataaactcgaccgaaggcgtgcgattggtgcgc
ggcagccacatcgtgacgcgcaaactctatgatcatgacaaatgttacttttttcagggc
atggacgggcgcatcatctttgccattccctatgagacggatttcacgttgatcgggacg
acggatgcagagcatcccgacccgtcggtgtcgcctgaatgcacgcctcaggagcgtgat
tatctgattgatttcgccaaccagtatttcgaccatgacataagccgcgacgatgtggtc
tggacctattccggggtgcgcccgctttacgatgatggggcaagcagtgcgacggcggcg
acgcgggactatacgctcaaggtggatgaggcaggtggcgcgccgatcctgaatgtcttt
ggcggcaagatcacgacctaccgcaagctggcagaggatgcgatggagcggatcgtgccg
ttctttcccggcacctcggggcattggacggcgggtgtgcccttgccgggcggcgatttc
gcggtcggggatttcgacacgcttgtcgcgcggctgcgtgatgattttccttttctttcg
catttttgcgcacgcaggctggtgcgcgcctatggcaccgaaagctgggacatcatggcg
ggtgcacagaaggttgaagaattgggcgaacacttcggtcatgggttacgcgcgcgcgag
gtgctctggctgatgacccatgaatatgcgcaaacagccgaagatatcctgtggcggcgc
aacaaattgggcttgcgcatgagtccgcaggaagtttctgttctggatgactttatgcag
gcacacaggctaaaagaaggctctgacgctgcacaataa

DBGET integrated database retrieval system