KEGG   Roseobacter denitrificans: RD1_3014Help
Entry
RD1_3014          CDS       T00376                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rde  Roseobacter denitrificans
Pathway
rde00010  Glycolysis / Gluconeogenesis
rde00020  Citrate cycle (TCA cycle)
rde00620  Pyruvate metabolism
rde01100  Metabolic pathways
rde01110  Biosynthesis of secondary metabolites
rde01120  Microbial metabolism in diverse environments
rde01130  Biosynthesis of antibiotics
rde01200  Carbon metabolism
Module
rde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RD1_3014 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RD1_3014 (pdhC)
   00620 Pyruvate metabolism
    RD1_3014 (pdhC)
Enzymes [BR:rde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RD1_3014 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABG32530
RoseoBase: RD1_3014
UniProt: Q164R3
LinkDB All DBs
Position
2889231..2890526
Genome map
AA seq 431 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDTVASGDIMAEIETDKATMEFEAVDEGTIGKIL
VEEGTEGVKVNTPIAVLLEDGESADDISAEPEPAAAATKEDAPAPTPEPTATPAPAAPQS
SDGSRIFASPLARRIAASNGVDLATVKGSGPHGRIVKADVEGLSASAAAPAPAAPGPAAP
APSAPVASGPAAEAVMAMYEGRAYDEISLNGMRKTIAARLTEAKQSIPHFYLRRDIELDA
LLAFRGQLNKQLESRGVKLSVNDFIIKACALALQTVPDANAVWAGDRMLKLTPSDVAVAV
AIEGGLFTPVLRDAEMKSLSALSAEMKDLAARARDRKLAPHEYQGGSFAISNLGMFGIDN
FDAVINPPHGAILAVGAGVKKPVVGKDGELAVATVMSVTLSVDHRVIDGALGAQLISAIK
ENLENPMTMLA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagaaattctcatgcccgccctgagcccgaccatggaagaaggcacactggcc
aaatggctggtgaaggagggggacaccgtggcctctggcgatattatggccgagatcgaa
accgacaaggcaacgatggaattcgaagccgttgatgaaggcaccatcggcaagatcctg
gtcgaagaaggcaccgaaggggtgaaagtgaacactccgatcgcggtgcttctggaagac
ggggaaagtgcggatgacatctctgccgaacctgagccggctgccgcagcaaccaaagag
gacgcacccgcacccacccctgaaccaacagcgacgcccgcgccggccgcgccgcagtcc
tcggatggatcacggatatttgcatcccctcttgcacgcaggatcgcggccagcaatggc
gttgatctggccacggtcaaagggtccggcccgcatgggcggatcgtcaaggcagatgtc
gaggggctcagcgcaagcgctgcggcccctgccccggctgcgcccggacctgcggctcca
gcgccgagcgcgccagttgcatcaggtcccgccgctgaagcggtgatggcgatgtatgaa
gggcgcgcctacgatgaaatcagcctcaacgggatgcgcaagacgatcgctgcgcgcctg
accgaagccaagcagtcgattccccatttctacctgcggcgcgacatcgagcttgatgcg
ctgttggccttccgggggcaattgaacaagcagctggaaagccggggcgtgaagctgtcg
gtgaatgatttcatcatcaaggcctgtgcgctggccctgcaaaccgtgccggacgcgaac
gccgtttgggccggggaccgcatgctgaaactcacaccgtctgacgtggctgttgccgtc
gcgattgagggtggattgttcacgccggttctcagggacgccgagatgaaatcgctctcg
gcgctctctgccgagatgaaggacctcgcggcgcgcgcgcgcgaccgcaagctcgccccg
cacgaatatcagggcggtagctttgcgatttccaatcttggcatgttcgggatcgacaac
ttcgatgcggtcatcaacccgccccacggtgctattctggcggttggtgcaggcgtgaaa
aaacctgtcgtcggcaaggacggtgaattggccgttgcgaccgtgatgtccgtcactctg
tccgtagaccacagggtgattgatggcgctctgggcgcgcaactcatatcggccatcaag
gagaaccttgaaaacccgatgacaatgctggcgtag

DBGET integrated database retrieval system