KEGG   Roseobacter denitrificans: RD1_3333Help
Entry
RD1_3333          CDS       T00376                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rde  Roseobacter denitrificans
Pathway
rde00970  Aminoacyl-tRNA biosynthesis
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RD1_3333 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rde03029]
    RD1_3333 (gatB)
Enzymes [BR:rde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RD1_3333 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RD1_3333 (gatB)
Mitochondrial biogenesis [BR:rde03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RD1_3333 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABG32832
RoseoBase: RD1_3333
UniProt: Q163L1
LinkDB All DBs
Position
3197980..3199491
Genome map
AA seq 503 aa AA seqDB search
MLDLTYETPAPKVISGAKEDWELVIGMEVHAQVTSAAKLFSAASTQFGAEPNNNVSFVDA
AMPGMLPTINEYCVEQAVRTGLGLKAEINLHSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVEMGNGTARLVRVERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYLGKLRQILRYLGTCNGDMQSGAMRADVNVSICRPGQYEKYQATQDFSHLGTRC
EIKNMNSMRFIQQAIEVEARRQIAIVEAGGTVDQETRLYDPDRNETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIAANLPELPDAKKARFRNDFGLSDYDASVLTADLDSAGYFEA
VAAGRDGKMAANWVINELFGRLKKEDHAITDSPVSPAQLGGIIDLIASDAISGKIAKDVF
EICYTTGRDPAEIVETEGMKQVTDTGAIEAAVDEIIAANPDQVAKARENPKLAGWFVGQV
MKATGGKANPKVVNQLIAKRLAE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatctgacttatgagacccccgcacccaaggtgatttccggtgcgaaggaagac
tgggaactggtcatcggcatggaggtgcacgcgcaggtcacctcggctgcgaagctgttt
tccgccgcctccacccaattcggggccgagccgaacaataatgtatccttcgttgatgcg
gccatgcccggtatgctgcccacgatcaacgaatactgtgttgaacaggcggtgcgcacc
gggctgggcctgaaggcagaaatcaacctgcacagcgcttttgaccgcaagaactatttt
tacccggatttgccacagggttatcagatcagccagctctaccacccgattgtcggtgaa
ggcgaagtgctcgtcgaaatgggcaacggcacggcccgtctggtgcgggtcgaacgcatt
caccttgaacaggacgcaggcaaatcgatccatgatatggacccgaacatgtcctttgtg
gacctgaaccgcaccggcgtcgccctgatggagatcgtctcgcgccccgacatccgcggc
cccgaagaagcggcggcctatctgggcaaactgcggcagatcctgcgctatctcggcacc
tgcaacggtgacatgcagtcgggcgccatgcgcgcggacgtcaacgtgtcgatctgccgg
cccggccagtacgaaaaatatcaggccactcaggacttcagccatctgggcacgcgctgc
gagatcaagaacatgaactccatgcggttcatccaacaggccatcgaggtcgaggcgcgc
cgccagatcgcgatcgtcgaggctggcggtacggttgatcaggaaacccgcctttatgat
cctgaccgcaacgagacacgctccatgcgctccaaggaagaggcgcatgactaccgctat
ttccccgaccccgacctgttgccgctcgaaatcgaacaggcatgggtggatgacatcgcc
gccaacctgcccgaactgcctgacgccaagaaggcgcggtttcgcaatgatttcggtctg
tcggattatgacgcttcggtgctgaccgccgatctggattcagcgggttatttcgaggcc
gtggcggcaggccgggatggcaagatggcggccaattgggtgatcaacgaactcttcggg
cggctcaagaaagaggaccacgccatcacggacagccccgtcagccctgcacaattgggc
ggcattatcgatctgatcgcctcggatgcgatctccggcaagatcgccaaggatgtcttt
gaaatctgctataccaccgggcgcgacccggcggagatcgtggaaaccgaaggcatgaaa
caggtcactgacacaggcgcaatcgaggctgccgtggatgaaatcatcgccgccaacccc
gaccaggtggccaaggcgcgcgaaaacccgaaacttgcgggctggttcgtcggtcaggta
atgaaagcgacaggcggcaaggccaaccccaaagtggtcaaccaactgattgcaaaaagg
cttgcagagtaa

DBGET integrated database retrieval system