KEGG   Roseobacter denitrificans: RD1_3494Help
Entry
RD1_3494          CDS       T00376                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rde  Roseobacter denitrificans
Pathway
rde00240  Pyrimidine metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RD1_3494 (tdk)
Enzymes [BR:rde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RD1_3494 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABG32978
RoseoBase: RD1_3494
UniProt: Q162W5
LinkDB All DBs
Position
3362618..3363241
Genome map
AA seq 207 aa AA seqDB search
MLYCGANRHGLSNRMAKLYFNYSTMNAGKSTVLLQAAHNYKERGMVPFLITAQVDDRAGD
GRIASRIGIGEPADTFTSGEDLFSKIDNRLKEGPVACVFVDEAQFLSTEQVWQLARAVDD
LGVPVMCFGLRVDFRGKLFPGSATLLALADEMREVRTICHCGKKASMVIRKDENGTVLRD
GAQIQVGGNETYVSLCRRHWREAAGDR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgctctattgcggcgcgaaccggcacggcctatcaaaccgcatggccaagctttacttc
aactactccacaatgaacgccggaaagtcgaccgttctgttacaggccgcgcacaactat
aaagagcgcggcatggtgccgttcctgatcacagcacaggtggatgaccgggccggcgac
ggtcgtattgcatcgcgcatcggcatcggtgagccggcggacaccttcacgagcggagaa
gaccttttttccaagatcgacaatcggttgaaggaaggcccggtcgcatgcgtttttgtg
gatgaggcgcaatttctcagcacggaacaggtatggcaactggcgcgcgcggtggatgat
ctgggtgtgccggtcatgtgctttgggctgcgggtggattttcgcggaaaactctttcca
gggtcggccacattgctggcgctggccgatgaaatgcgcgaggtgcgcaccatttgccat
tgcggcaagaaagccagcatggtcatccgcaaagacgaaaacgggaccgtgttgcgcgat
ggcgcgcaaatacaggtcggcggcaacgagacttatgtatcgctctgccgccgccattgg
cgcgaagccgccggcgaccgttag

DBGET integrated database retrieval system