KEGG   Roseobacter denitrificans: RD1_3765Help
Entry
RD1_3765          CDS       T00376                                 

Gene name
xylA
Definition
(GenBank) xylose isomerase, putative
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
rde  Roseobacter denitrificans
Pathway
rde00040  Pentose and glucuronate interconversions
rde00051  Fructose and mannose metabolism
rde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RD1_3765 (xylA)
   00051 Fructose and mannose metabolism
    RD1_3765 (xylA)
Enzymes [BR:rde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RD1_3765 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABG33233
RoseoBase: RD1_3765
UniProt: Q161W0
LinkDB All DBs
Position
complement(3646755..3647741)
Genome map
AA seq 328 aa AA seqDB search
MKDPNTPLFAARLNAFKIGADAYWPGKNTVTTADLLGRAATAGLTAADLNYPDHFVSDTP
AQLTEALQGNGMVLNGMAMRYYTDPGYKLGAFTHPDASVRRAAIDETKRGLDVLAQMGGR
LMTLWMGQDGFDYSFQMDYTRAWDHTITAITEVADHNPTLDIALEYKPNEPRAFALMPDA
ATTLLALREVDRPNTGVTLDFAHVLYADEMPAFAAALVARHSRILGVHLNDGYGKWDNGL
MVGAVHPVQTIELLVELTRAGYDGAIYFDTFPDHSGLDPVAEARTNIDVVNRLRAIAQGL
AGDADLQAAIARQDAPLSMRLVQAAMLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcccaacacccccctttttgcagcccggctgaatgctttcaagatcggtgct
gacgcctattggcccggcaaaaacacggtcacaactgccgatctgctgggccgcgcggcc
acggcagggctgacagcggcggatttgaattaccccgatcacttcgtcagcgatacgcct
gcgcaactgaccgaggccttgcagggcaacggcatggtgctcaacggcatggccatgcgg
tactacaccgacccgggctataaactgggggccttcacgcatcccgatgccagcgtccgg
cgcgcggccatagatgaaaccaaacgcgggctcgatgtgctggcgcagatgggcgggcgt
ctgatgacgctctggatggggcaggacgggttcgattattcgttccagatggattacaca
cgcgcatgggaccacacgatcaccgcgatcactgaggttgccgatcacaacccgaccctt
gatatcgcgttggaatataaacccaatgagccgcgcgcctttgccctgatgcccgatgcg
gccacgacccttcttgcgctcagggaggttgaccggcccaataccggtgtaactcttgat
tttgcccatgtgctttatgccgacgagatgcccgcttttgccgccgccctcgtggcgcgt
cattcgcgcatcctcggtgtgcatcttaacgatggctacgggaaatgggacaacgggctg
atggtgggggccgtgcatccggtgcagaccattgaactgctcgtggaactgacgcgcgca
gggtatgatggggcgatttatttcgataccttcccggaccattccggtcttgacccggtg
gcagaggcgcgcaccaatatcgacgtggtgaaccggctgcgcgcgattgcgcaggggctt
gccggggatgctgatctgcaagcggccatcgcccgacaggatgcgcccctgtccatgcgg
ctggtacaggcggccatgctgaaatga

DBGET integrated database retrieval system