KEGG   Roseobacter denitrificans: RD1_4248Help
Entry
RD1_4248          CDS       T00376                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rde  Roseobacter denitrificans
Pathway
rde00620  Pyruvate metabolism
rde00680  Methane metabolism
rde01100  Metabolic pathways
rde01120  Microbial metabolism in diverse environments
rde01200  Carbon metabolism
Module
rde_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RD1_4248 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    RD1_4248 (ppc)
Enzymes [BR:rde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RD1_4248 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABG33683
RoseoBase: RD1_4248
UniProt: Q160B0
LinkDB All DBs
Position
4124362..4126977
Genome map
AA seq 871 aa AA seqDB search
MAAALDTQAGPGPASDAGDLYQCLRAAWSRVLERRAPQLLDATQQDGAQWHRDHYGDHLQ
ASTIWFHLQQVLNEVQTLRSLRQEATNGKLHGFAEVVADCPEDQRAAMKRLLQDGRLSVG
PTITAHPTEAKRVTVMEIHRRIYALLCCADDTARLAEVSTSLEMEIDLLWLTGELRMERP
SLAAEVEWGLQFYDASLFDAVPRLFQRYRTAVRSAFGAEVDDHCCLRFHSWIGGDRDGNP
NVTAEVTRQALARSREMVLNAYVRALEKIVPRLSISTKIVPLPADHLQALERIVDQRSTD
AESCKQRNPNEVFRQAGFAIRDAVAAGRYAHISDFLADLSVLENALNAIGATALAGQLIR
PLRWQATTFGFRGHTLDIRQNSDVVTRTLQAVWAAVDASPEPLGSAWSERLQREVRQETL
PTLDGLELSEEASELLALLALVRDVHEGSDPDAIGPFVLSMTRSADDLLAVLLLARYVGF
DAHQPSLRVVPLFETIEDLQAAPVILRDVLAVPIAARSMKSSGGRIEIMLGYSDSNKDGG
FLCSSWSLDRAQRAITRTLAQQGATPVFFHGRGGSVSRGGAPTDRAIAAQPCGTLNGALR
LTEQGEVVTAKYANADTAVTQLELLASSVLRHSASPPFETVDPEGEDVMETLSSLSQTAY
QNLLRHPGFLDYFNQASPVNELALLKIGSRPARRFGAASLSDLRAIPWVFAWSQNRHMIS
SWYGFGQAIQDFRRVRGSVGDAALERISRKLPLFQLCLDEIEKSLMLVRLDIAELYARLV
SDRAMAEDVFGRIRDEYNRSVDAIETLTGAPLGTRFPNAADRIHRHEDTLRAAHHAQVAL
LKDVRASDAQTARIRLMQSMNCISAGLGWTG
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcattggacactcaggcgggcccgggcccggcatcggatgcgggcgatctg
tatcagtgcctgcgcgcggcatggtcccgcgtattggaacgtcgcgcgccgcagcttctg
gacgcaacgcaacaggatggggcgcagtggcaccgcgaccactacggcgatcatcttcag
gccagtaccatctggtttcacctgcagcaggttttgaatgaggttcagaccctgcgcagc
ctcagacaagaagcgacaaatggaaagttacatggctttgcagaagtcgtcgcagactgc
ccggaggatcagcgcgcggcgatgaagcggctgctgcaggatgggcgcctcagtgttggc
cccacgatcaccgcgcatccgaccgaagcaaagcgcgtgaccgtaatggaaattcaccgt
cggatttatgcgctgctttgttgcgcggacgacacggcacgccttgccgaggtgagcaca
tcgcttgagatggaaatcgacctgctgtggctcacgggtgagctacggatggagcgccca
tcgctcgccgccgaggtagagtgggggctgcaattctatgacgcgagcctctttgatgcc
gtgccccgcctgtttcagcggtatcgcaccgctgtccgctcggcctttggcgctgaagtc
gatgatcattgctgtcttcgctttcattcctggattggcggggatcgcgacggcaacccc
aatgtcacggccgaggtgacacgtcaggcgctggcccgatcccgtgaaatggtcctgaac
gcctatgtgcgcgcattggaaaagatcgtgccgcggctgagcatctcgacaaaaatcgta
ccgctccctgcggatcatctccaagcgcttgaacgcattgtcgatcaacgcagcacggat
gccgaaagctgcaagcagcgcaacccgaacgaggtgtttcgccaggcgggttttgcgatc
cgcgacgcggtggctgcgggcagatacgcgcatatctctgacttccttgccgatttgtcg
gttctcgaaaacgcgttgaacgccatcggcgcaacagcgctggccggtcaactgatccgg
cccctgcgctggcaagccaccacattcggctttcggggccatacgctcgacattcgccag
aactccgacgtggtgacacggacacttcaggccgtctgggccgccgttgacgcatctccc
gagccgcttggctccgcgtggtccgaacggttgcagcgcgaggtgagacaggaaacgtta
ccgacccttgacggcctcgagctgtccgaagaggccagcgagcttctggcgctgctggcg
ctggtgcgcgatgtgcatgaggggtctgacccggatgcgatcgggcctttcgttctgtcc
atgacgcgttctgccgatgatcttttggcggttctgctgcttgcaagatatgtgggcttt
gatgcgcatcaaccctccctgcgggttgtccccttgttcgaaaccatcgaggatttgcag
gcagcgcccgtgatcctgcgcgatgttttggcggtcccgattgccgcgcgcagcatgaaa
tcatccgggggccggatcgagatcatgctcggctattcggacagcaacaaggatggtggc
ttcctgtgctcaagctggtcgctcgaccgggcgcaacgggccatcacgcgaacgcttgca
cagcagggcgcaacgccggtgttctttcacggtcgtggcggttcggtcagccggggcggc
gcgcccaccgaccgcgccatcgccgcgcagccctgcggcaccctgaacggagcattgcgc
ctgaccgagcagggcgaggttgtcacggcaaaatacgccaacgcggacacggcggtgaca
cagcttgaactgctcgcctcttcggtgttgcgtcacagtgcatcaccccccttcgaaacc
gtcgatcccgaaggcgaagacgtgatggaaacactgtcgagcctcagccagaccgcctat
cagaacctgctgcgccatcccggcttccttgactacttcaatcaggccagccccgtgaac
gaacttgccctgctcaagatcggctcgcggcccgcgcgccggttcggggcggcgtcactg
tcggatttgcgcgccatcccttgggtctttgcctggagccagaatcgccacatgatcagc
agttggtacggcttcggtcaggccattcaggatttccgcagggtgcgggggagcgtcggc
gacgctgcactggagcggatttcgcgcaagctgcccctctttcagctttgtctcgatgaa
atcgaaaagtcgctgatgttggtgcggctcgatattgcggaactctatgcccggctggtg
tctgatcgggcgatggcagaggatgtgttcgggcgtatccgtgatgaatataaccggtcc
gtggatgccattgaaacgctgacgggtgccccacttggcacacgtttcccgaacgcggcg
gatcgcatccaccgtcatgaggacacgttgcgcgccgcgcatcatgcgcaagttgcgctc
ctgaaagacgtgcgcgcaagtgacgcgcaaaccgcacgcattcgcctgatgcaaagcatg
aactgcatttccgctggtcttggctggacaggttaa

DBGET integrated database retrieval system