KEGG   Rhizorhabdus dicambivorans: CMV14_02435Help
Entry
CMV14_02435       CDS       T05084                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rdi  Rhizorhabdus dicambivorans
Brite
Enzymes [BR:rdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CMV14_02435
Peptidases [BR:rdi01002]
 Metallo Peptidases
  Family M2
   CMV14_02435
Exosome [BR:rdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMV14_02435
CD molecules [BR:rdi04090]
 Proteins
  CMV14_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ATE63397
UniProt: A0A2A4FXU5
LinkDB All DBs
Position
501430..503292
Genome map
AA seq 620 aa AA seqDB search
MRYPIKAATSALAIATLFAATPVLAKKKDKPADPAPVAAQAAPTVAEADAFVARAEQELN
DLGIYGAQVAWINSTYITDDTDAVNARVGAEFTELQVRLANGAARFDGLDGLSYDTKRKL
DALKQSIVLPAPSTPGAAKELNDLATRLQSAYGKGKGTLRGKEINGSDIEAEMGTNRNPA
ELKEMWLSWHDQVGKPMAGDYAKLVEIANQGAIDLGYKDLGAMWRSGYDMPADDFAKMMD
RLWVQVKPLYDALHCYTRTKLNAKYGDAVQPKAGPIRADLLGNMWAQEWGNIYDIVAPKG
AGDIGYDVEELLKAKQYDPVKMVKTGEGFYSSLGFAPLPDSFWTRSQITKPRDREVVCHA
SAWDIDNKDDLRIKMCTKVNSDDFVTIHHELGHNYYQRAYNKQSYLYLNGANDGFHEAIG
DFVALSITPDYLVKIGLLDPAKVPSADKDIGLLLRQAMDKVAFLPFGLLMDKWRWGVFNG
SIRPANYEKAWTDLRLQYQGIVPPADRPDDAFDPGAKYHIPGNTPYARYFLARILQFQFY
KAACDQAGWKGPLHRCSFYGDKEVGKKLDAMLAMGSSKPWPDALEAFTGSREIDGTAMIA
YFQPLIGWLEQQNKGQRCGW
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagatacccgatcaaggcggccacatcggcgctcgccatcgcaaccctgttcgccgcc
acccccgtcctggcgaagaagaaggacaagccggccgatcccgcccccgtcgcggcccag
gcggctccgaccgttgccgaagccgacgccttcgtcgccagggccgagcaggaattgaac
gatctcggcatctatggcgcgcaggtcgcctggatcaattccacctatatcaccgacgac
accgacgcggtgaacgcgcgggtcggcgccgaattcaccgagctgcaggtccgcctcgcc
aacggcgcagcgcgcttcgacgggctcgatgggctcagctacgacacgaagcgcaagctc
gacgcgctcaagcagagcatcgtcctgcccgcgccctccacccccggcgcggccaaggag
ctcaacgacctcgcgacccggctccagtccgcctatggcaagggcaagggcacgctacgc
ggcaaggagatcaacggctcggacatcgaggccgagatggggaccaaccgcaacccggcc
gagctgaaggagatgtggctgagctggcacgatcaggtcggcaagccgatggcgggcgac
tatgccaagctggtcgagatcgccaaccagggcgcgatcgaccttggctacaaggatctc
ggcgcgatgtggcgttcgggctatgacatgcccgccgacgatttcgcgaagatgatggac
cggctgtgggtgcaggtgaagccgctttacgacgcgctccactgctatacgcggacgaag
ctcaacgcgaaatatggcgatgccgtccagcccaaggccggcccgatccgcgccgatctg
cttggtaacatgtgggcgcaggaatggggcaatatctatgacatcgtcgcccccaagggt
gctggcgacatcggctatgatgtcgaggaactgctcaaggccaagcaatatgatccggtg
aagatggtgaagaccggcgagggcttctattcctcgctgggcttcgcgccgctgcccgac
agcttctggacccgctcgcagatcaccaagccgcgcgaccgcgaggtggtgtgccacgcc
tcggcgtgggacatcgacaacaaggacgatctgcgcatcaagatgtgcaccaaggtgaac
tccgacgacttcgtcaccatccaccatgaactgggccataattactatcagcgcgcctat
aacaagcagagctacctctacctcaacggcgccaatgacggcttccacgaggcgatcggg
gatttcgtcgcgctgtcgatcacgcccgactatctggtgaagatcggcctgctcgatccc
gccaaggtgccgagcgcggacaaggatatcggcctgctgctgcgccaggcgatggacaag
gtggctttcctgccgttcggcctgctgatggacaagtggcgctggggcgtgttcaacgga
tcgatccggcccgccaattacgagaaggcgtggaccgacctgcggctgcaatatcagggc
atcgtgcccccggccgatcggcccgacgacgccttcgatccgggcgccaaatatcatatc
ccgggcaacacgccctatgcgcgctatttcctcgcccgcatcctccagttccagttctac
aaggcggcgtgcgaccaggcgggctggaagggcccgcttcaccgctgctccttctacggc
gacaaggaggtcggcaagaagctcgacgcgatgctggcgatgggatcgtccaagccctgg
cccgatgcgctggaggccttcaccggcagccgggagatcgatggaacggcgatgatcgcc
tatttccagccgctgatcggctggctcgaacagcagaacaagggccagcgctgcggctgg
tga

DBGET integrated database retrieval system