KEGG   Rhizorhabdus dicambivorans: CMV14_02595Help
Entry
CMV14_02595       CDS       T05084                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rdi  Rhizorhabdus dicambivorans
Pathway
rdi00620  Pyruvate metabolism
rdi00680  Methane metabolism
rdi01100  Metabolic pathways
rdi01120  Microbial metabolism in diverse environments
rdi01200  Carbon metabolism
Module
rdi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMV14_02595
  09102 Energy metabolism
   00680 Methane metabolism
    CMV14_02595
Enzymes [BR:rdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CMV14_02595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 ACT_5 Arabino_trans_N
Motif
Other DBs
NCBI-ProteinID: ATE63425
UniProt: A0A2A4G0X6
LinkDB All DBs
Position
complement(542504..545185)
Genome map
AA seq 893 aa AA seqDB search
MSSAPPITQNPDIRFLGRLLGDVIKAYGGEALFRRIEYIRSASVDRARGIVGSQEIDSGL
DALTLDDTLAFVRGFMLFSMLANLAEDRQGVTAEPGADVGAALDRLEKQGISRSKVVEML
ETALIAPVLTAHPTEVRRKSMIDHRNKISELMILKDIGRVETVDGDLIDQAIYRQIALLW
QTRPLRRERLYVADEVETALAYLRDIFLPTLPALYSRWGRALGHRPASFLRPGTWIGGDR
DGNPFVTADSLRLALSRAAETVVGYYLKELHELGAELSISTELAEVTWEVEKLAEASGDK
SSTRSDEPYRRAITGIYSRLSKTYQQLTGRTPARLPFSEAEHGAYQDPASLRADLVEIAH
ALNRTGAGSLSGNGALGRLIRAVETFGFHLATLDMRQNADVHERVVADLLKVAGVEADYL
ALDEAARVALLRSELASKRLLRTPFGAYAEETLSELAIVEAAAEAHRLYGPQAITTYLIS
KADNVSDMLEVNILLKEAGLYVPGDPPAAAIMAVPLFETIGDLERAPEVMTRYFGLPEVA
AITAARGHQEVMVGYSDSNKDGGYLTSVWSLHEASSALRKVFAEAGTAIQLFHGRGGAVG
RGGGSSFAAILAQPHGTVQGRIRITEQGEVIAAKYGTRESAAANLEAMTSATLLATLEEE
SLRPEDRKRFFAAMDDISGRAFKAYRGLVYETEGFRTFFRQMTPIAEIADLKIGSRPASR
TKSDRIEDLRAIPWVFSWAQARVMLPGWYGVGHGLKGHKDIGLLREMLEAWPFFQSTLAN
LEMVLAKSDMDLAERYVALVEDQAMGKAIFGEIRDGWERSQEALLSITRQTRLLQKNPSL
DQSIRLRLPYIEPLNLLQIELLKRHRAGEDDPRVREGIQLSINAIATALRNSG
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgcaccgccgatcacccagaaccccgacatccgcttcctcggccgcctgctc
ggcgacgtgatcaaggcctatgggggagaggcgctgttccggcggatcgaatatatccgc
tcggcctcggtcgatcgggcgcgcgggatcgtcggcagccaggagatcgactcgggcctc
gacgcgctgaccctcgacgatacgctcgccttcgtgcgcggcttcatgctgttctcgatg
ctcgccaaccttgccgaggaccggcagggcgtcaccgccgagccgggcgccgacgtcggc
gccgcgctggaccggctggagaagcagggcatttcccgatccaaggttgtggagatgctg
gagaccgcactgatcgccccggtgctgaccgcccacccgaccgaggtgcggcgcaagtcg
atgatcgatcatcgcaacaagatatccgaactgatgatcctgaaggacatcggccgggtc
gaaaccgtcgatggcgacctgatcgaccaggcgatctaccgccagatcgcgctgctgtgg
cagacccgccccttgcgccgcgaacggctctatgtcgccgacgaggtcgagaccgcgctg
gcctatctgcgcgacatcttcctgccgaccctgcccgcgctctattcgcgctggggccgc
gcgctgggccatcgcccggcgagcttcctgcgccccggcacctggatcggcggcgatcgc
gacggcaacccgttcgtcaccgccgattcgctgcggctggcgctgtcgcgcgcggccgag
acggtggtgggctattatctgaaggagctgcacgagctgggcgccgaactgtcgatctcg
acggagctggccgaggtgacctgggaggtggagaagctggccgaggcatcgggtgacaag
agctcgacccgcagcgacgagccctatcgccgcgcgatcaccggcatctattcgcgcctg
tccaagacctatcagcagctgaccggccgcacgcccgcccgcctgccgttcagcgaggcc
gagcatggcgcctatcaggaccccgcctcgctgcgcgccgacctggtcgagatcgcccat
gcgctcaaccgcaccggcgcgggatcgctgtcgggcaatggtgcgctgggccggctgatc
cgcgcggtcgagactttcggcttccacctcgccacgctcgacatgcgccagaatgccgac
gtccatgaacgggtcgtcgccgacctgctgaaggtcgccggggtcgaggccgattatctc
gcgctggacgaggcggcgcgggtggcgctgctgcgctccgaactggcatcgaagcgcctg
ctgcgcaccccgttcggcgcctatgccgaggagacgctgtcggagctggcgatcgtcgag
gctgccgccgaggcgcaccggctgtacggcccgcaggcgatcaccacctacctcatctcc
aaggccgacaatgtctcggacatgctggaggtgaacatcctgctcaaggaagcggggctc
tacgtgccgggcgatcccccggctgcggcgatcatggcggtgccgctgttcgagacgatc
ggcgacctcgaacgcgcgcccgaggtgatgacccgctatttcggcctgcccgaggtcgcc
gcgatcaccgccgcgcgcggccatcaggaggtgatggtcggctattcggattcgaacaag
gacggcggctacctcacctcggtctggagcctgcacgaggcatcgagcgcgctgcgcaag
gtgttcgccgaggccggcaccgcgatccagctgttccacggccggggcggcgccgtcggg
cgcggcggcggatcgagcttcgccgcgatcctcgcccagccgcacggcaccgtgcagggc
cgcatccgcatcaccgagcagggcgaggtgatcgccgccaaatatggcacccgcgagagc
gcggccgccaatctggaggcgatgacctccgccaccctgctcgcgacgctggaggaggag
agcctcaggcccgaggaccgcaagcgcttcttcgcggcgatggacgacatttcgggccgc
gccttcaaggcctatcgcgggctggtgtacgagaccgagggtttccggaccttcttccgc
cagatgaccccgatcgccgagatcgccgacctgaagatcggatcgcgcccggccagccgc
accaaaagcgaccggatcgaggatctgcgcgccatcccctgggtgttcagctgggcgcag
gcgcgggtgatgctgccgggctggtacggcgtcggccatggcctgaagggccacaaggac
atcggcctgctgcgcgaaatgctggaggcctggcccttcttccagtcgaccctcgccaat
ctggagatggtgctcgccaagtcggacatggacctggctgagcgctatgtcgcgctggtc
gaggatcaggcgatgggcaaggcgatcttcggcgagatacgcgacggctgggagcggagc
caggaggcgctgctgtcgatcacgcggcagacacggctgctccagaagaacccgtcgctc
gaccagtcgatccggctgcgcctgccctatatcgagccgctcaacctgctccagatcgaa
ctgctcaagcgccaccgcgccggcgaagacgatccccgggtgcgcgagggcatccagctc
tcgatcaacgcgatcgcgacggcgctgaggaacagcgggtag

DBGET integrated database retrieval system