KEGG   Rhizorhabdus dicambivorans: CMV14_05915Help
Entry
CMV14_05915       CDS       T05084                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rdi  Rhizorhabdus dicambivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ATE63982
UniProt: A0A2A4FR47
LinkDB All DBs
Position
1237814..1239289
Genome map
AA seq 491 aa AA seqDB search
MTDTLVNLSNPEKLFIGGDWAASSDGGGIEIVSPSTEEVVGRVGKATKADMDRVVAIARQ
AFDHGPWPRTTGSERAKVLRRIAEEMTKRADDFARAWSLQVGMPYAQSSMTAPYMAAYFT
YFADLAEQGFEEVRKPMLGGHCIVVREPAGVVVAVVPWNAPLATLLLKVAPALAAGCVVI
AKPSPETPLEALILAECIAAAGVPEGVFSVVTADREVSDHLIRNADVDKVSFTGSTAAGL
HIASVCGGRMARVTTELGGKSAAIILDDADIGAVVAGIMPNLVGLCGQQCAAFSRILVSA
ARKAEVTEAVAAAMRAVTVGDPFDQATQMGPLVTRSQHGRVFGYIEKGKAEGARLVTGGG
RPTHLARGWFVEPTLFADASNDMVIAREEIFGPVGTVIAYDSEEQAVAIANDSNYGLSGG
VFTQDPDRAYAMARRIRTGNFGHNGRVIDFTMPYGGFKQSGIGREGGVEGLHAFTEVKAV
FMPELPSHLRS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgctggtgaacctgtcgaacccggagaagctgttcatcggcggcgactgg
gcggcctcgtcggacggcggcgggatcgagatcgtctcgccctcgaccgaggaggtggtc
ggccgggtcggcaaggcgacgaaggcggatatggatcgggtcgtcgcgatcgcgcgccag
gctttcgatcatggcccctggccgcgtaccacgggctccgagcgggccaaggtgctgcgc
cggattgccgaggagatgacgaagcgcgccgacgatttcgcccgcgcctggtcgctccaa
gtcggcatgccctatgcccagtcgtctatgaccgcgccttatatggcggcctatttcacc
tattttgccgaccttgccgagcagggcttcgaggaggtccgcaagcctatgctgggtggc
cactgcatcgtcgtgcgcgagccggcgggcgtcgtagtggcggtcgtgccatggaacgcg
ccgcttgcgacattgctactgaaggttgcgccggcgctggcggcgggttgcgtcgtgatc
gccaagccttcgcccgaaacccccctcgaggcgctgatcctcgccgaatgcatcgctgcc
gccggggtgcccgaaggggtgttctcggtcgtcaccgccgatcgcgaagtctctgatcat
ctgatccgcaatgccgatgtcgacaaggtcagcttcaccggttcgaccgccgccggcctg
cacatcgcgtcggtgtgcggcggccggatggcgcgcgtcaccactgagctgggcggcaag
tccgccgcgatcatcctcgacgatgccgatatcggcgcggtcgtcgccgggatcatgccg
aatctggtcggcctgtgcggccagcaatgtgccgccttcagccgcattctcgtctctgcc
gcgcgcaaggccgaagtgaccgaggcggtcgcggcggcgatgcgcgcggtgacggtcggc
gatcccttcgaccaggcaacccagatgggtccgctcgtcacccgcagccagcatggccgg
gtgttcggctatatcgagaagggcaaggccgagggcgcccgcctcgtcaccggcggcgga
cggccgacgcacctcgccaggggctggttcgtcgaaccgaccttgttcgccgacgccagc
aacgacatggtgatcgcgcgcgaggagattttcggcccggtcggcaccgtcatcgcctat
gacagcgaggagcaggcggtcgccatcgccaatgacagcaattacggtctgtctggcggg
gtgttcacccaggaccccgatcgtgcctatgcgatggcacggcgcatccgcaccggcaat
ttcgggcataatggccgggtgatcgacttcaccatgccttatggcgggttcaagcagtcc
gggatcggccgcgagggcggggtcgaggggctgcatgccttcaccgaggtcaaggcggtg
ttcatgcccgaactcccttcccacctccggtcatga

DBGET integrated database retrieval system