KEGG   Rhizorhabdus dicambivorans: CMV14_21215Help
Entry
CMV14_21215       CDS       T05084                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rdi  Rhizorhabdus dicambivorans
Pathway
rdi00473  D-Alanine metabolism
rdi00550  Peptidoglycan biosynthesis
rdi01100  Metabolic pathways
rdi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CMV14_21215
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CMV14_21215
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CMV14_21215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rdi01011]
    CMV14_21215
Enzymes [BR:rdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CMV14_21215
Peptidoglycan biosynthesis and degradation proteins [BR:rdi01011]
 Precursor biosynthesis
  Amino acid ligase
   CMV14_21215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ATE66623
UniProt: A0A2A4G1L3
LinkDB All DBs
Position
4515634..4516572
Genome map
AA seq 312 aa AA seqDB search
MTVKPLHVAVLMGGWSSEREVSLTSGNGVADALESLGHKVTRIDMGRDVALRLAEAKPDV
VFNALHGTPGEDGTVQGMMDLMGLAYTHSGLTTSVIAIDKELTKQQLVPHGIRMPEGKVV
ESESLYEGDPLPRPYVLKPVNEGSSVGVAIIKERDNHGSPIHREAHGPWQSFPTLLAEPF
IRGRELTVAVLGDRALGVTELVPSSGFYDYEAKYTDGLTTHICPADVPQDIADAAMKMAL
DAHRLLGCKGTSRSDFRWDDEQGEAGLYLLEVNTQPGMTPLSLVPEQARHVGMTYADLVQ
AIIDEAIEGDSA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgaaacccctccacgtcgctgtcctcatgggcggctggtcgtccgagcgcgag
gtgtcgctgacctccggcaacggcgtcgccgatgcgctggaaagcctgggccacaaggtc
acccggatcgacatgggccgcgacgtcgccctcaggctcgccgaggcgaagcccgatgtc
gtgttcaacgcgctgcacggcacgccgggcgaggacggcaccgtccagggcatgatggac
ctgatggggctggcctatacccattcgggcctgaccacctccgtcatcgcgatcgacaag
gaactgaccaagcagcagctcgtcccccacggcatccgcatgcccgagggcaaggtggtg
gagagcgagagcctgtacgagggcgacccgctgccccgcccctatgtactcaagcccgtc
aacgaaggctcgtcggtcggcgtcgcgatcataaaagagcgtgacaatcatggctcgccg
attcatcgtgaagcgcatggtccctggcagagcttcccgaccttgctggccgagcccttc
atccggggccgcgaactgaccgtcgcggtgctcggtgatcgcgccctgggcgtgaccgag
ctggtgcccagcagcggcttctatgattatgaggccaaatataccgacggcctgaccacc
catatctgcccggccgacgtgccccaggacattgccgacgcggcgatgaagatggcgctc
gacgcgcaccggctgctcggctgcaagggcacgtcgcgctccgatttccgctgggacgac
gagcagggcgaggccgggctctatctgctcgaggtcaacacccagccgggcatgaccccg
ctgagcctggttcccgagcaggcccgccatgtcggcatgacctatgccgatctggtccag
gcgatcatcgacgaggcgatcgaaggagacagcgcatga

DBGET integrated database retrieval system