KEGG   Rhizorhabdus dicambivorans: CMV14_25180Help
Entry
CMV14_25180       CDS       T05084                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rdi  Rhizorhabdus dicambivorans
Pathway
rdi00061  Fatty acid biosynthesis
rdi00780  Biotin metabolism
rdi01100  Metabolic pathways
rdi01130  Biosynthesis of antibiotics
rdi01212  Fatty acid metabolism
Module
rdi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CMV14_25180
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CMV14_25180
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CMV14_25180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rdi01004]
    CMV14_25180
Enzymes [BR:rdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CMV14_25180
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CMV14_25180
Lipid biosynthesis proteins [BR:rdi01004]
 Fatty acid synthase
  Component type
   CMV14_25180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ATE67826
UniProt: A0A2A4FXL4
LinkDB All DBs
Position
p2:136431..137204
Genome map
AA seq 257 aa AA seqDB search
MKPLVDLTGKRGLVIGIANAHSIAAGCAQAFHDCGARLAATYLNGKAEPFVAPVAETLGV
EWLAACDVRVPGEVEALFERVKSEWGGLDFLLHSIAFAPKEDLHGRVVDSSAEGFALAMD
VSCHSFLRMARLAEPLMSDGGRLLCVTFYGSERVVEHYNLMGPVKAALESATRYVAAELG
PKGIRAHAISPGPIATRAASGIDRFDELLERAAATVPQHQLVTIEDVGGLAAFLVSDAGR
HITGTIIPVDGGQHLLG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctctcgtcgatcttactggcaagcgcggcctggtgatcggtatcgccaacgcg
catagcatcgcggcgggttgcgcccaggcctttcacgactgtggggcgagactggcggcg
acctatctcaacggaaaggccgagccgttcgtggcgcccgtcgcggagaccctgggagtc
gaatggctcgccgcgtgcgatgtccgggtgccgggcgaagtggaggccctgttcgagcgg
gtgaagtccgaatggggcggcctcgatttcctgcttcactcgatcgctttcgcgccgaag
gaggatttgcacggccgcgtcgtcgacagctcggccgaaggcttcgcgctggcgatggac
gtctcgtgccacagcttcctgcgcatggcgcgtctcgccgagccgctgatgtcggatggc
ggccgcctgctgtgcgtcaccttctacgggtcggagcgggtggtcgagcactacaacctg
atggggccggtcaaagcggccctcgaaagcgcgacccgctatgtcgcggctgagcttggc
cccaagggcattcgcgcccatgcgatctcgccaggcccgatcgcgacccgcgctgccagc
ggcatcgaccgcttcgacgagctgctcgaacgggccgcggcgacggtcccgcagcaccag
ctcgtgaccatcgaggatgtcggagggctcgccgcctttctggtgagcgatgccggccgc
catatcaccggcacgatcattccggtcgatggcggtcagcacctgctcggctag

DBGET integrated database retrieval system