KEGG   Roseateles depolymerans: RD2015_1011Help
Entry
RD2015_1011       CDS       T04166                                 

Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00860  Porphyrin and chlorophyll metabolism
rdp01100  Metabolic pathways
rdp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RD2015_1011
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RD2015_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB SRP54 MipZ AAA_10 AAA_16 DUF87 AAA_26 CBP_BcsQ RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ALV05505
UniProt: A0A0U2TZB2
LinkDB All DBs
Position
complement(1140669..1141574)
Genome map
AA seq 301 aa AA seqDB search
MSTISVPLSTIGQRRPDGAGSVQVQMDPDLQIGTAKCFAIYGKGGIGKSTTSSNLSAAFS
KLGKRVLQIGCDPKHDSTFTLTKRMLPTVIDVLETVNFHAEELRVEDFVYEGYNGVMCVE
AGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHADRAMIV
TANDFDSIFAMNRIVQAIGAKAKNYKVRLGGVIANRSAATDQIDRYTERTGLKLSARFPD
LDVIRRSRLKKSTLFEMEASPELEQVQQEYLRLAASMWTGGTPYEAVPMKDRDLFDLLGF
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatctccgttcccttgagcaccatcggccagcgacggcccgatggcgccggc
agcgtccaggtccagatggaccccgacctgcagatcggcaccgccaagtgcttcgccatc
tacggcaagggcggcatcggcaaaagcacgacgtcgagcaatttgtcggctgccttctcc
aagctgggcaagcgggtgctgcagatcggctgcgaccccaagcacgactccaccttcacc
ctgaccaagcgcatgctgcccaccgtcatcgacgtgctggagacggtcaacttccatgcc
gaggaattgcgggtggaagacttcgtctacgagggctacaacggcgtgatgtgcgtggag
gcgggcggaccgccggcgggcaccggctgcggcggttatgtcgtgggccagacggtgaag
ctgctcaaggagcaccacctgctggaagacaccgacgtggtgatcttcgacgtgctgggc
gatgtggtgtgcggcggctttgccgcgccgctgcagcacgccgaccgggccatgatcgtc
accgccaacgacttcgattccatcttcgcgatgaaccggatcgtgcaggccatcggcgcc
aaggccaagaactacaaggtgcggctgggcggcgtgatcgccaaccgcagcgccgccacc
gaccagatcgaccgctacaccgaacgcaccgggctgaagctctcggcgcggttcccggac
ctggacgtcattcgccgcagccgcctgaagaagtcgaccctgttcgagatggaggcttcg
cctgagctggagcaggtgcagcaggaatacctgcggctggcggcgtcgatgtggaccggc
ggcacgccgtatgaagcggttcccatgaaggaccgcgacctcttcgacctgctgggattc
gactga

DBGET integrated database retrieval system