KEGG   Roseateles depolymerans: RD2015_122Help
Entry
RD2015_122        CDS       T04166                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RD2015_122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rdp02000]
    RD2015_122
Enzymes [BR:rdp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RD2015_122
Transporters [BR:rdp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RD2015_122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_2 GST_N_3 GST_C_6 GST_N_5 Tom37
Motif
Other DBs
NCBI-ProteinID: ALV04627
UniProt: A0A0U3MNZ8
LinkDB All DBs
Position
140084..140692
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVAREAGLDVEIVLASTKTHQLQDGTDFYTLNPKGYVPLLELDNG
QRLSEGPAIVQYLADLAPGSGLAPANGTMERYRLQEWLNFITSELHKGFSPLFNPAMPEE
AKAQFRTKLLDRLKWVDAQLEGRSYLMGETFTVADAYLFTVTGWGRLVGVDVSPFAQLVA
FRERVAARPAVQEAMKQEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacagccccggcgcctgctccctgtcgccccacatcgtcgcgcgtgag
gcgggcctggacgtggagatcgtgctggccagcaccaagacccatcagctgcaggacggc
accgacttctacacgctcaatcccaagggctacgtgccgctgctggagctggacaacggc
cagcgcctgagcgaaggcccggccatcgtgcaatacctggccgacctggcgcccggcagc
ggtctggcacccgccaacggcacgatggagcgctaccggctgcaggagtggctcaacttc
atcacgagcgagctgcacaaaggcttcagcccgctgttcaatccggcgatgccggaggag
gccaaggcgcagttccgcaccaagctgctggatcgcctgaagtgggtggatgcccagctg
gaaggccgcagctatctgatgggggagaccttcaccgtggcggatgcctatctcttcacc
gtcaccggctgggggcgcctcgttggtgtggacgtcagcccgtttgcccagctggtggcc
ttccgcgaacgcgtggcggcccgtcctgccgtgcaggaagccatgaagcaggaagggctg
ctgaagtaa

DBGET integrated database retrieval system