KEGG   Roseateles depolymerans: RD2015_1517Help
Entry
RD2015_1517       CDS       T04166                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00061  Fatty acid biosynthesis
rdp00780  Biotin metabolism
rdp01100  Metabolic pathways
rdp01212  Fatty acid metabolism
Module
rdp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RD2015_1517
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RD2015_1517
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rdp01004]
    RD2015_1517
Enzymes [BR:rdp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RD2015_1517
Lipid biosynthesis proteins [BR:rdp01004]
 Fatty acid synthase
  Component type
   RD2015_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ALV06002
UniProt: A0A0U3LHQ5
LinkDB All DBs
Position
1785454..1785912
Genome map
AA seq 152 aa AA seqDB search
MNESSKIDIHGILAKLPHRYPILLVDRVLEVEKGVRIRALKNVSINEPFFQGHFPHRPVM
PGVLILEALAQAATLLAVQSYDFSLDENHVVYFAGIDGARFKRPVEPGDQLLLDVTLERA
KAGIYKFGAKALVGQDIVAEAGLMCTMRRLDC
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagagcagcaaaatcgacatccacggcatcctggcgaagctgccgcaccgctat
cccatcctgctggtggaccgggtgctggaagtggagaagggcgtgcgcatccgtgcactg
aagaacgtcagcatcaacgagccgttcttccagggccacttcccgcatcgtccggtcatg
ccgggcgtgctcatcctggaagcgctggcccaggcggccacgctgctggcggtgcagagc
tacgacttctcgctggacgagaaccatgtcgtgtacttcgccggcatcgacggcgcgcgt
ttcaagcgtccggtggagccgggtgaccaactgctgctggatgtcacgctggagcgggcc
aaggccggtatctacaagtttggcgccaaggccctggtgggccaggacatcgtggccgaa
gccggcctgatgtgcaccatgcgccgtctggactgctga

DBGET integrated database retrieval system