KEGG   Roseateles depolymerans: RD2015_1654Help
Entry
RD2015_1654       CDS       T04166                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rdp  Roseateles depolymerans
Brite
KEGG Orthology (KO) [BR:rdp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RD2015_1654
Enzymes [BR:rdp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RD2015_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_3 NAD_binding_7 AlaDh_PNT_C NAD_binding_8 Thi4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ALV06138
UniProt: A0A0U3MP63
LinkDB All DBs
Position
1938981..1940534
Genome map
AA seq 517 aa AA seqDB search
MLDDNLKAQLKAYLERVTLPFEIEASLNDSESSAQLKQLLQDIDAMSDKITLKLDGNDAR
RPSFSLKRTGTEQSLRFAGIPLGHEFTSLVLALLWTGGHPPKVEQSTIDQVKGLDGDYAF
EVYMSLSCHNCPDVVQALSLMAVLNPRVKTVIIDGGLFQDEVNAREIMAVPAVYLNGSHF
GSGRMTVEEIVAKLDTNAGAKDAAKLSSKEAFDVLVVGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVNDTLAIENYISVLSTDGPKFAMALESHVKDYGVDVMNLQRADKLIPSATPGG
LIEVQLANGASLKSKTVILSTGARWRNVNVPGEEEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLVAHVTLLEFGDQLRADAVLVKKLESLSNVTIIKQAQTTEFTGAG
GKLNGLNYTDRATGEARRIELEGVFVQIGLVPNTEWLRGVVELSKHGEIIVDAKGQTSVP
GVFAAGDATTVPYKQIIIAAGDGAKAALSAFDHLIRN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaacctgaaggcgcagctcaaggcctacctggagcgggtgacgcttccg
ttcgagatcgaggcctcgctgaacgactctgagagctcggcgcagctcaagcagctgctg
caggacatcgacgcgatgtccgacaagatcaccctgaagctggacggcaacgatgcccgc
cgcccgtcgttcagcctcaagcgcaccggcaccgagcaaagcctgcgctttgccggcatc
ccgctgggccacgagttcacctccctggtgctggccctgctgtggaccggcggccatccg
cccaaggtggagcagtccaccatcgaccaggtcaagggcctggacggcgactacgccttc
gaggtgtacatgtccctgtcctgccacaactgcccggacgtggtgcaggccctgtcgctc
atggcggtgctgaacccccgcgtcaagaccgtgatcatcgacggcggcctgttccaggac
gaggtcaatgcccgcgaaatcatggcggtgccggcggtctacctgaacggctcgcacttc
ggctcgggccgcatgacggtggaagagatcgtcgccaagctggacaccaacgccggtgcc
aaggacgcagccaagctgtcgtccaaggaagcctttgacgtgctggtggtgggtggtggc
ccggccggtgctgcggccgcggtgtatgccgctcgcaagggcatccgcaccggtgtggcg
gccgagcgcttcggcggtcaggtcaacgacacgctggccatcgagaactacatctcggtg
ctgtccaccgacggtcccaagttcgccatggcgctggagtcccatgtgaaggactacggc
gtggacgtgatgaacctgcagcgcgccgacaagctgatcccgtcggcgacgccgggcggc
ctgatcgaggtgcaactggccaacggggcctcgctcaagagcaagaccgtgatcctgtcg
accggcgcccgctggcgcaatgtgaatgtgccgggcgaagaggaatacaagaacaagggt
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagccgccatcgacctggccggtctggtggcccatgtg
acgctgctggagttcggtgaccagttgcgtgccgatgcggtgctggtgaagaagctggag
agcctgtccaacgtcaccatcatcaagcaggcgcagaccaccgagttcaccggcgcaggc
ggcaagctcaacggcctgaactacaccgaccgcgcgaccggcgaagcccgccgcattgaa
ctggaaggcgtgtttgtgcagatcggcctggtgcccaacaccgagtggctgcgcggtgtg
gtggaactgtccaagcacggcgagatcatcgtggatgccaagggccagacttcggtgccc
ggtgtgttcgccgccggggatgcgaccaccgtgccctacaagcagatcatcatcgcggcc
ggtgatggtgcgaaggcggccctgtcggcctttgatcacctcatccgaaactga

DBGET integrated database retrieval system