KEGG   Roseateles depolymerans: RD2015_253Help
Entry
RD2015_253        CDS       T04166                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rdp  Roseateles depolymerans
Pathway
rdp00473  D-Alanine metabolism
rdp01100  Metabolic pathways
rdp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rdp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RD2015_253
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RD2015_253
Enzymes [BR:rdp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RD2015_253
Peptidoglycan biosynthesis and degradation proteins [BR:rdp01011]
 Precursor biosynthesis
  Racemase
   RD2015_253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALV04756
UniProt: A0A0U3MSA4
LinkDB All DBs
Position
complement(274266..275369)
Genome map
AA seq 367 aa AA seqDB search
MPRPIEALIHQPALAHNLHRARECAPDAQVFAIVKANAYGHGIDRVFDAFRAADGFALLD
LDEAQRIRDLGWRGPILLLEGCFEPRDLELCSRLRLWHAVHSEQQIDWLAMHKTHEPHRV
FLKLNSGMNRLGFTPSGFRAAWTRLNALPQVDEISLMTHFSDADGPKGIDRQLAVFQEAT
ADLPGERSLSNSAAVLRHSERAGVRADWVRAGIMSYGSAPDFPEHDIRHWNLQPTMTLRS
KVLAVQALQPGDTVGYGSTFVADRPMRIGTVACGYADGYPRHAGTGTPVLVGGQRTRTVG
RVSMDMLAVDLTDLPQLGAGSEVTLWGQGPNGSMLSIDEVAAAAGTIGYELMCALARRVP
VHLDPLT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtcctattgaagccctcatccatcagcccgccctggcccacaacctgcaccgg
gcccgcgaatgcgcccccgacgcgcaggtgtttgccatcgtcaaggccaatgcctacggg
cacggcatcgaccgcgtcttcgacgccttccgcgccgccgatggcttcgccctgctggac
ctggacgaagcccagcgcatccgtgacctgggctggcgcggccccatcctgctgctggaa
ggctgtttcgagccgcgggacctggaactgtgctcgcggctgcggctgtggcatgcggtg
cattccgagcagcagatcgactggctggccatgcacaagacccatgagccgcaccgtgtc
ttcctcaagctcaacagcggcatgaaccggctcggattcacgcccagcggcttccgtgcg
gcctggacgcggctcaatgccctgccccaggtggacgagatttccctgatgacccacttc
tcggacgccgacggccccaagggcatcgaccggcagttggcggtcttccaggaagcgacg
gcggacctgccgggtgagcgctcgctcagcaacagcgccgcggtgctgcggcacagcgag
cgggcaggcgtgcgggcggactgggtgcgcgccggcatcatgagctacggcagcgccccg
gatttcccggaacacgacatccgccactggaacctgcagcccaccatgacgctgcgcagc
aaggtactggcggtgcaggctctgcaacccggcgacacggtcgggtacggcagcaccttc
gtcgccgaccggccgatgcgcatcggcaccgtcgcctgcggctatgccgacggctatccg
cgtcatgccggcaccggcaccccggtgctggtgggcggacagcgcacccgcaccgttggc
cgggtgtccatggacatgctcgcggtggacctgaccgatctgccgcagctgggcgccggc
agcgaggtcaccctctggggccagggcccgaatggcagcatgttgtcgatcgatgaagtg
gcggccgctgccggcaccatcggctatgagctgatgtgcgccctggcgcgccgggtgcca
gtgcacctggacccgctgacctga

DBGET integrated database retrieval system